(data stored in ACNUC7421 zone)

EMBL: CP000271.PE444

CP000271.PE444       Location/Qualifiers
FT   CDS_pept        517881..518717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2581"
FT                   /product="Putative citrate lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2581"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33412"
FT                   /db_xref="GOA:Q13R77"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R77"
FT                   /protein_id="ABE33412.1"
FT                   /translation="MSAALPRSYLFVPGNRPERFEKAHASGADAVILDLEDAVPPDEKP
FT                   AARAVVLAAVSGDATGPAARPEARPAWVRINGADTSWFNEDIAALAGQAGVAGIVLPKA
FT                   ETREQIEAVLALAHSASSVLPIVETARGFANLAVLCAAPRVQRIVFGTLDFQIDLGIDG
FT                   DGEELHLFRSQIVLASRLAGIGAPVDGVSTTITDTDGIEAEARRGRRFGFGAKLCIHPR
FT                   QIDAVHRAYAWSEADKAWAQRVLAAVETSQGAAVAVDGKMVDMPVILKARRIAAGA"
     atgagcgccg cgctgccgcg ctcctacctg ttcgtgccgg gcaatcgtcc agagcgcttc        60
     gaaaaagcgc acgcgtcggg cgctgacgcg gtgattctcg atctcgaaga cgccgtgccg       120
     cccgacgaaa aaccggcggc gcgcgcggtg gtgctggccg ctgtatcggg cgatgcaacg       180
     gggcctgcag cgcggcctga agcgcggccc gcgtgggtgc gcatcaacgg cgcggacacc       240
     tcgtggttca acgaggacat cgccgcactg gccggccagg ccggcgtcgc cggcatcgtg       300
     ctgcccaaag cggagacgcg cgagcagatc gaagccgtgc tggcgctcgc acattccgcg       360
     tcgagcgtgt tgccgatcgt cgaaaccgcg cgcggatttg cgaatctcgc ggtgttgtgc       420
     gccgcgccgc gcgtgcaacg catcgtgttc gggacactgg attttcagat cgatctcggt       480
     atcgatggcg acggcgagga actgcatctg ttccgctcgc agatcgtgct ggcgtcgcgg       540
     cttgccggga tcggcgcgcc ggtggacggc gtgtcgacca ccatcaccga taccgatggc       600
     atcgaggccg aggcgcgccg cggccggcgc ttcggcttcg gcgccaagct gtgcattcat       660
     ccacggcaga tcgatgcggt gcatcgcgct tacgcatgga gcgaagcgga caaggcgtgg       720
     gcgcaacgcg tgctggccgc ggtggaaacg agccagggcg cagccgtggc ggtggacggc       780
     aagatggtcg atatgccggt gattctgaag gcgcgacgga tcgcggcggg cgcgtaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page