(data stored in ACNUC7421 zone)

EMBL: CP000271.PE445

CP000271.PE445       Location/Qualifiers
FT   CDS_pept        complement(518827..519279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2580"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2580"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33413"
FT                   /db_xref="GOA:Q13R76"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R76"
FT                   /protein_id="ABE33413.1"
FT                   /translation="MAILPAPLSRPGREHPRPGATDISGISKMSRVLLVDDQPEALSAL
FT                   RAVLVGRGYTVATAADGAEAFERLQRTRVSAVVCDWRMPNMDGAELIESMQARSELASV
FT                   PVILTSGSGEVPAFPVKGFLRKPFALDKLLSLLAECESDAATPAVC"
     atggcgattt tgcctgcacc cctgtcgcga ccgggccgcg aacacccgag gcccggtgca        60
     accgatatct caggcataag caaaatgagt cgcgtattac tggtcgacga ccaacccgag       120
     gcattgtccg cgctgcgcgc cgtattggtc ggccgtggtt acacggtcgc cacggcggcg       180
     gatggcgccg aagcttttga acgactgcaa cgcacgcgcg tgagcgccgt cgtgtgtgac       240
     tggcgcatgc ccaacatgga cggcgccgag ttgatcgaat cgatgcaggc ccgcagtgaa       300
     ctggcgtccg tacccgtcat tctgacgagc ggcagcggcg aggtgccggc ctttcccgtc       360
     aaaggctttc tcaggaaacc gttcgcgctg gacaagctgc tctcgttgct ggccgaatgc       420
     gaaagcgacg cggcgacgcc tgccgtctgc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page