(data stored in ACNUC7421 zone)

EMBL: CP000271.PE447

CP000271.PE447       Location/Qualifiers
FT   CDS_pept        520730..522229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2578"
FT                   /product="Putative aldehyde dehydrogenase family protein"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2578"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33415"
FT                   /db_xref="GOA:Q13R74"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R74"
FT                   /protein_id="ABE33415.1"
FT                   /translation="MDASTILADLGIAHAAQAGDIAVHSPITGELIGRVASNTVAEVDT
FT                   ALAQAKQAYTAWRNVPAPRRGELVRLLGNRLREKKQALGSIITLETGKILQEGMGEVQE
FT                   MIDICDFAVGLSRQLYGLTIASERPGHRMAETWHPVGTCVVISAFNFPAAVWSWNAALA
FT                   LVCGNAVIWKPSEKTPLTALAVNQILSEALQEFGDAPAGLTALINGGRDVGAKLVADPR
FT                   ASIVSATGSTEMGRTVGVEVAKRFGRSLLELGGNNAGIVTQTADHELAMRGILFSAVGT
FT                   AGQRCTSLRRLFVHESVYDKTIERLKQLYSKVPIGNPLEKGTLMGPLIDKQSYGRMQEA
FT                   LQQATAEGGKVFGGERVEVKGYEGGYYVRPAIVEMPSQTSVVLKETFAPILYVLRYTDF
FT                   ADAVEANNAAVHGLSSCVFTTDLREAERFLSDSGSDCGIANVNIGPSGAEIGGAFGGEK
FT                   ETGGGRESGSDAWKAYMRRATNTVNYSSALPLAQGIDFNIG"
     atggacgctt ccaccatcct cgccgacctg ggcatcgccc acgcggcgca agccggcgac        60
     atcgcggttc attcgcccat taccggcgaa ctcatcggcc gcgtggccag caacaccgtg       120
     gcggaagtcg acacggccct cgctcaggcg aaacaggcgt acaccgcctg gcgcaacgtc       180
     ccggcgccgc gccgcggcga actggtgcgt ctgctcggca accgtctgcg tgagaagaag       240
     caggcgctcg gcagcatcat cacgctcgag accggcaaga ttcttcagga aggcatgggc       300
     gaagtgcagg aaatgatcga catctgcgat ttcgcggtcg gtctgtcgcg ccagttgtac       360
     ggtctgacga tcgcttcgga acgtccgggg caccgcatgg cggagacgtg gcatcccgtg       420
     ggcacttgcg tcgtgatctc ggcattcaat tttccggctg cggtgtggtc gtggaatgcg       480
     gcgctcgcgc tggtctgcgg caatgcggtg atctggaagc cgtcggaaaa gacgccgctt       540
     accgcgctcg ccgtcaatca gattctgagc gaggcgctgc aggagttcgg cgacgcgccg       600
     gccggcctca ccgcgttgat caacggcggc cgcgacgtgg gcgcgaagct ggtggccgac       660
     ccgcgcgcgt cgattgtcag cgctacgggc agcacggaaa tgggccgcac ggtcggcgtg       720
     gaagtggcga agcgctttgg ccgctcgctg ctcgaactcg gtggcaacaa cgcgggcatc       780
     gtcacgcaaa cggcggatca cgaactcgcc atgcgcggca ttctgttttc ggcggtgggt       840
     acggcggggc aacgttgcac gtcgctgcgc cgtttgttcg tgcacgagag cgtgtacgac       900
     aaaaccatcg aacgtctgaa gcagctgtac agcaaggtgc cgatcggcaa tccgctcgaa       960
     aagggcacgc tgatggggcc gctgatcgac aagcaatcgt atggccgcat gcaggaagcg      1020
     ctgcaacagg ctacggccga aggcggcaag gtgttcggcg gcgagcgcgt cgaggtgaag      1080
     ggatatgaag gcggctacta cgtgcgaccg gcgattgtcg aaatgccgtc gcaaacgtcg      1140
     gtggtgctga aggaaacgtt cgcaccgatt ctgtacgtgc tgcgctatac cgatttcgcc      1200
     gacgcggtgg aagcgaacaa tgcggcggtg catggtttgt cgtcgtgtgt attcaccacc      1260
     gatctgcgcg aagcggaacg cttcctgtcc gattcgggca gcgactgcgg tatcgcgaac      1320
     gtcaacatcg ggccgagcgg cgcggaaatc ggcggcgcgt tcggcggcga gaaagaaacc      1380
     ggcggcggcc gcgaatcggg ttcggacgcg tggaaagcct atatgcgccg cgctaccaac      1440
     acggtcaatt actcgtcggc attgccgctc gcgcagggta tcgacttcaa tatcggctga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page