(data stored in ACNUC7421 zone)

EMBL: CP000271.PE45

CP000271.PE45        Location/Qualifiers
FT   CDS_pept        48549..52052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2983"
FT                   /product="Periplasmic sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2983"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33013"
FT                   /db_xref="GOA:Q13SC6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC6"
FT                   /protein_id="ABE33013.1"
FT                   /translation="MQKILDRTQESLALAFATLAQNAKRQQRVYLATIGSLMLVVAIFA
FT                   LVLAVVAGLAQLDYRRTFASQNATDISLLLHQEESFSRRVELTFDYYYTAPHVRSAPEA
FT                   VQQSIRRTGVVRGKVDRIDAGFDMLVGEATTTAWGPQLGEKLGRLYEASQSTLATQQAF
FT                   ELQQRATLVGLTEDYAVILPSLAQPVAGKAAAAKLSAVPQQQLAFVRTLRETLERQLEA
FT                   QTGRRLPGKGERVWLGPYLDPLENVPVISAVSVYYDGGTPTTLISMNIRLDVLARRIAP
FT                   PGDEGTILLMAADRRIIASSKPLGMQTGKMLQQTVAATPSHVFHYGREGVIFHEPLGPG
FT                   FGFLVGYLPWGALAVALGWQLAVIAALTALILLAVALTARYFGFRLLRNAFAETSRSLE
FT                   SETINHVLVSATPVGLCVVRQGDYSVLTANALAAELLSIEPGGNRLPPHIVGEFLAQTP
FT                   GKPSAAAIARIAAFVVAARPQSPASAPSEEGAPPARFLQFTYAPARYAGENVLFCAILD
FT                   VTAQTLLEQQLRHAQQTSDAMMRARTNFFAAMSHEIRTPLNALLGNLELFARTPGLEAH
FT                   SQRLATLSVASDALRRVVNDILDFSKIDAGEMLLANEPFRPIDEFENIAFSHAPLCGDR
FT                   AIRFYALLSPTLDCTLIGDRMRIAQVVNNLLSNAFKFTSSGKITLYAEVKDDPQGRPTL
FT                   LCRISDSGAGMSEELLARLFKPFVQGALGTSRGTGGTGLGLVICARLCELMGGRISAES
FT                   VPGVGSVFHVSIPLVAVPGDQRTPVAIPASRGTALVLCTERQAGEFLDGWLQRAGWSSH
FT                   TVMSLAGAEAWLKANRPAVLIVSGEYDLEAIVGLRALQAVGVVWITSGGPTRPEARAQG
FT                   VLEVSEFSRTACLTAIELAVEGASAAPAEASAAASALTPSVEIDPALLGLAVLVAEDNP
FT                   LIQNLIAEQLVELGCVPTIAADGKQALALFERAPFEVVLTDVHMPVMDGHELLTALRER
FT                   HAELPVLAFSAAAEEQQAQSWHERGFNGYVSKPASLSELQAALLAVVPAPARAARAKAA
FT                   STAESASADSVAPVANVASMLSADDKARYTAMLREHLQKDLPRLLAIVEEEDVRALAGW
FT                   AHSASGAFVVVQEPEFFDQCRQLQRLCADNSEWTTEMDERAISLHEALSDHYGLDEQPA
FT                   R"
     atgcagaaga tcctcgaccg tacacaagag tccctggcgc tcgctttcgc cacgctggcg        60
     cagaacgcga agcgccagca gcgggtttat ctggcgacaa tcggttcgct catgctggtc       120
     gtggcgatct tcgccctcgt gctggctgtc gttgccgggc tcgcgcaact cgactatcgc       180
     cgcaccttcg catctcaaaa tgcaaccgac atctcccttc tcctgcacca ggaggagtcg       240
     ttctcgcggc gcgtcgagct tacgttcgat tactactaca ccgctcccca cgtgcgcagc       300
     gcgccggagg ccgttcagca gtcgatccgc cggaccggcg tggtgcgcgg caaggtggac       360
     cggatcgatg ccggcttcga catgctcgtc ggcgaagcca ccacgacggc ctgggggccg       420
     caactcggcg agaaactcgg ccgtttgtac gaagcgtcgc agtcgacgct tgcaacgcag       480
     caggcgttcg agttgcagca acgggccacg ctggtcgggc tgacggaaga ctatgccgtg       540
     atcctgcctt cgctcgcgca accggtggcg ggaaaagccg ccgccgcgaa actgtccgct       600
     gtgccccagc agcaactggc tttcgtcagg acgctgcgcg agacgctcga acgccagctc       660
     gaggcgcaaa ccggcaggcg tctgccgggc aaaggcgagc gcgtctggct gggtccctat       720
     ctcgatccgc tggagaacgt tccggtgatc tcggcggtga gcgtctacta cgacggcggc       780
     acgcctacga cgctcatcag catgaatatc cggctcgacg tgctggcgcg gcgcatcgcg       840
     ccgccgggcg acgagggcac gatactgctg atggccgcgg atcgccgcat tatcgcgtcc       900
     tcaaagccgc tcggcatgca gaccggcaag atgctgcaac agaccgtggc cgcgacaccg       960
     tcgcatgtat ttcactacgg gcgtgaaggc gtgatctttc atgagccgct ggggccgggg      1020
     ttcggcttcc tggttggcta tttgccgtgg ggggcgctcg ccgttgcgct tggctggcaa      1080
     ctcgcggtga tcgccgctct cacggcgctg atcctgctgg cggttgcgct gacggcgcgc      1140
     tatttcggtt ttcggctgtt gcgcaatgcg tttgccgaaa cctctcgctc gctggaaagt      1200
     gaaaccatca atcacgttct ggtcagtgcg acgccggtcg gcctgtgcgt cgtccgtcaa      1260
     ggcgactatt ccgttctgac cgccaacgcg ctggccgcgg agttgctgag tatcgagccg      1320
     ggcggcaacc ggttgccgcc gcatatcgtg ggcgagttcc tcgcgcagac gcccggcaaa      1380
     ccttcggccg cggcgattgc gcggatcgcc gctttcgttg tggccgcacg gccgcagtcg      1440
     ccggcttcgg caccgtcgga agaaggcgcc ccgcccgcgc ggttcttgca gtttacctat      1500
     gcccccgcgc gctacgcggg tgagaacgtg ctgttctgcg cgattctcga cgtcaccgcc      1560
     cagaccctgc tcgaacagca gttgcggcac gcgcagcaga cttccgacgc gatgatgcgg      1620
     gcgcgcacga atttcttcgc ggcgatgagc cacgagatcc gcacgccgtt gaacgcgctg      1680
     ctcggcaatc tcgaactgtt cgcgcgcacg cccggtctcg aggcgcattc gcagcggctc      1740
     gcgaccctga gtgtcgcgtc ggatgcgctg cgccgagtcg tcaacgacat tctcgacttc      1800
     tcgaagatcg atgccggcga gatgctgctc gccaacgagc cgttccggcc catcgacgaa      1860
     tttgaaaata tcgcgttctc tcacgcgccg ttgtgcggcg accgcgcgat ccgtttctat      1920
     gcgctccttt cgccgacgct cgactgcacc ctgatcggcg atcgcatgcg aatcgcgcaa      1980
     gtcgtcaaca acctgctgag caacgcgttc aaatttacgt cctccggcaa gatcacgctg      2040
     tatgcggaag tgaaagacga tccgcaaggc cgcccgacgc tcctctgcag gatttcggac      2100
     tccggcgccg gcatgagcga ggaactgctg gctcgtctgt tcaaaccatt cgtgcaaggg      2160
     gcgctcggta cttcgcgcgg aacgggcggg accggtctgg ggctcgtgat ttgcgcgcgg      2220
     ctatgcgaat tgatgggcgg tcggatctcc gccgaaagcg tacccggtgt gggcagcgta      2280
     tttcatgtat cgatcccgct cgtcgcggtg cccggtgatc agcgcacgcc ggtcgcgatc      2340
     cccgcgtcgc gcgggaccgc gctcgtgctg tgcacggagc gccaggccgg cgagtttctg      2400
     gacggctggc ttcagcgagc gggctggtcg agccacacgg tgatgtcgct ggctggcgca      2460
     gaggcgtggt tgaaggcgaa tcgcccggcg gtattgatcg tgtccggtga atacgatctc      2520
     gaggcgattg tcggcttgcg cgcgttgcag gcggtcggcg tagtgtggat cacgagcggt      2580
     ggcccgaccc ggccggaggc gcgcgcccag ggtgtgctcg aagtgagcga attcagccgg      2640
     accgcgtgtc tgacggcaat cgaactggcc gtcgagggcg cctccgccgc gccggccgaa      2700
     gcgtccgcgg cggcctccgc cttgacgcct tctgtcgaga tcgatcccgc gctgctgggt      2760
     cttgcggtcc tcgtcgcgga agataatccg ctgatccaga acctgatcgc ggagcaactg      2820
     gtcgagctcg gctgtgtgcc gacgattgcc gcggatggca agcaggcgct ggcactcttc      2880
     gaacgggcgc cgttcgaggt ggtgctgacc gacgtccata tgccggtgat ggacggccat      2940
     gagttgctga cggcattgcg cgagcggcac gctgagttgc ccgtgctggc ctttagcgcc      3000
     gcagccgaag agcagcaggc tcaaagctgg cacgagcgcg ggtttaacgg gtacgtttcc      3060
     aagccggcgt ccttgagtga actgcaggcg gctttgctgg cggttgtgcc cgctccggcg      3120
     cgcgcggctc gcgccaaggc ggcatcgaca gcggaatcgg catcggccga ctccgtggcg      3180
     cccgtcgcca acgtagcgag catgctcagc gcggacgaca aggcgcgcta caccgcgatg      3240
     ctcagggagc atttgcagaa agatctgccc aggttgctcg ccattgtcga ggaagaggac      3300
     gtgcgggcgt tggccggctg ggcgcatagc gcgagcggtg cgttcgtggt cgtgcaggag      3360
     ccggagtttt tcgaccaatg ccggcaattg caacggctat gcgccgacaa cagcgagtgg      3420
     acaaccgaga tggacgaacg ggccatctcg ctgcacgaag ccttatccga tcactacgga      3480
     ctcgacgagc agccggcgcg ttga                                             3504
//

If you have problems or comments...

PBIL Back to PBIL home page