(data stored in ACNUC7421 zone)

EMBL: CP000271.PE450

CP000271.PE450       Location/Qualifiers
FT   CDS_pept        525342..527150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2575"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2575"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33418"
FT                   /db_xref="InterPro:IPR018671"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R71"
FT                   /protein_id="ABE33418.1"
FT                   /translation="MKMSRKKIAILVVGLLVVAGVIIQAVWRPFAHRKAAGNGEIVLDI
FT                   HHPDAVIDSEALSRLPRDILSVPLLRDVLTQDFVDYYESDNTRLSAEGALRRLAFEHQL
FT                   DWRDELIRRVFDEPAHVLLWRSPDGRLGYWVMSMHRNGFAKLLQGVGNVATSDAQLSQV
FT                   AKLSGDVPVYALKLAVGRTLLFASKDDRLVVLSAPGVLLDEKGGLLGERADVVSGMLSS
FT                   GRDDAARAYQLDAPGESPKGHRLVVSANYLSFGYQAFFSGIDALRFDFSSTGNPAGGRG
FT                   VANWQTSALIVPDKLPQQWNSADLWRALPANPAACTSLPADWKEASGLLGKVAGGGADN
FT                   AAAIGDQLTGPAAVCWYAKSTLVAPVFVARVKKQDAADIAALKTALGKTFGDVIGAYEA
FT                   KAAKADGADSAGYRRLPVTTREQGADVTVWQRPVSARSGTALTSKASFASQLSAERYFP
FT                   VTLALAHGYLIFSPDGRLVDDTLAVLDKRYPALADTLAPQRLPRTILTLTPSSAAALIE
FT                   REAGAALPADQEAVFRNASRTHLVPKLHALAHYPPVSLTLPQNLPGSTGWVPVEWWFDR
FT                   ARAGAGSGSTEGAADTPADQPGTGGD"
     atgaagatgt cgcgcaaaaa gattgcaatc ctggtcgtcg gtcttctggt cgtggccggc        60
     gtgatcattc aggcggtatg gcgtccattt gcgcatcgca aagcagccgg gaacggcgaa       120
     atcgtcctcg atattcacca cccggatgcg gtgatcgaca gcgaagcgct ctcgcgtttg       180
     ccgcgcgaca ttctgagtgt gccgctgctg cgcgacgtgc tgacgcaaga tttcgtcgac       240
     tattacgagt cggacaacac gcggctgtcg gccgagggcg cgttgcggcg tctcgcgttc       300
     gaacatcaac tcgactggcg cgacgaactg atccgccgtg tattcgacga acccgcgcac       360
     gtgctgctgt ggcgctcgcc cgacggccgc ctcggctact gggtgatgtc gatgcatcgc       420
     aatggtttcg cgaagctgct gcaaggcgtg ggcaacgtcg ccacgagcga cgcgcaactg       480
     agccaggtgg cgaagctctc cggcgatgtg ccggtctatg cattgaaact cgcggtcggc       540
     cgcacgctgc tgttcgccag caaagacgat cggctggtcg tgctgtccgc gcccggtgtg       600
     ctgctcgacg agaagggcgg actgctcggc gagcgggccg acgtggtgtc cgggatgttg       660
     tcctcgggcc gcgatgatgc agcgcgcgcc tatcaactag acgcgcccgg cgaatcgccg       720
     aagggccacc ggctggtggt gtcggccaac tacctgtcgt tcggctatca ggcgtttttc       780
     tccggcatcg acgcgctgcg tttcgatttt tcgtcgaccg gcaatcccgc aggggggcgt       840
     ggcgtggcga actggcagac ctcggcgctg atcgtgccgg acaagttgcc gcaacagtgg       900
     aacagcgccg atctgtggcg cgcgttgccg gccaacccgg cggcctgcac gagcttgccg       960
     gcggactgga aagaggcctc gggcctattg ggtaaggtgg ccggcggcgg cgcggataac      1020
     gctgccgcga tcggcgatca gctcaccggt cccgcggcgg tgtgctggta tgcgaagtcg      1080
     acgctggtcg cgccggtgtt cgtcgcgcgc gtgaagaagc aggacgcggc cgatatcgcc      1140
     gcgttgaaga ccgcgctggg caaaaccttc ggcgatgtga tcggcgccta tgaagcgaag      1200
     gccgccaaag ccgacggcgc cgactccgcg ggctatcgcc gcctgccggt caccacgcgc      1260
     gagcagggcg cggatgtgac cgtgtggcag cggccggtca gcgcgcgttc gggcacggca      1320
     ttgacgagca aggcgtcgtt cgcatcgcag ttgtcggcgg agcgttattt cccggtcacg      1380
     ctggcacttg cgcacggcta tttgatcttc tcgccggacg gccgcctcgt cgacgacacg      1440
     ctcgcggtgc tcgacaagcg gtatccggcg cttgccgata cgctcgcgcc gcagcgtctg      1500
     ccgcgcacga ttctgacgct cacgccttcg tcggccgccg cgttgatcga acgtgaggcg      1560
     ggcgcggcgt tgcccgcgga tcaggaggcg gtgttccgca acgcatcgcg tacgcatctc      1620
     gtgccgaagc tgcacgcgct tgctcactac ccgccggttt cgctgacgct gccgcagaac      1680
     ctgccgggtt cgaccggctg ggtgccggtg gagtggtggt tcgatcgcgc gagggctggt      1740
     gccggttccg gttcgactga aggcgctgcc gatacgcccg cagatcagcc cggcaccggg      1800
     ggcgactga                                                              1809
//

If you have problems or comments...

PBIL Back to PBIL home page