(data stored in ACNUC7421 zone)

EMBL: CP000271.PE451

CP000271.PE451       Location/Qualifiers
FT   CDS_pept        527343..528116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2574"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2574"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33419"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009558"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R70"
FT                   /protein_id="ABE33419.1"
FT                   /translation="MQSTHAAQSTHAAQSTHAAQSTTLAVHAATTSRRAWLASAACAFA
FT                   VASLTPYAHALTDTAASPDPDALSPQQSAAFRAWFVRIVDQQMRRGPTPRWTQRDCAGL
FT                   VRFAVGETLRPHDTRWLRANGMTSLADTSSMPPELQLSAAQRGIANRWTQLDGSTGAYA
FT                   SAIALIQRNSRFVSKDVNQALPGDLLFFDQGDDQHLMIWLDRYIAYHTGTVTLTDTGLR
FT                   AVSVSDLMQWKDSRWQPLDGNPNFVGVFRLDFLTP"
     gtgcagtcaa cgcatgctgc gcagtcaacg catgctgcgc agtcaacgca tgctgcgcag        60
     tccacgactc tcgcagtcca cgccgccacc acctcgcgcc gcgcgtggct cgcaagcgcc       120
     gcctgcgcat tcgccgtggc gagtctcacg ccctacgccc acgcgctcac cgacaccgcc       180
     gcatcacccg accccgacgc gctgtcgccg cagcaatcgg cggcattccg cgcgtggttc       240
     gtgcgcatcg tcgatcagca gatgcggcgc ggaccgacgc cgcgctggac ccaacgcgac       300
     tgcgcgggcc tcgtgcgctt cgcggtcggc gagacgctca ggccgcacga cacccgctgg       360
     ctgcgcgcca acggcatgac cagtctcgcg gataccagca gcatgccgcc cgaactgcaa       420
     ctgtccgcgg cgcagcgtgg aatcgccaac cgctggaccc aactcgacgg ttccaccggc       480
     gcatacgcat cggcgatcgc actgattcaa cgcaatagcc gttttgtttc gaaggacgtg       540
     aaccaggcgc tgcccggcga tctgctgttc ttcgaccagg gcgacgacca gcatctgatg       600
     atctggctgg atcgctacat cgcttatcac acaggcaccg tcacgctgac cgataccggt       660
     ctgcgcgccg tctccgtttc cgacctgatg caatggaaag actcccgctg gcagccgctc       720
     gacggcaatc cgaatttcgt cggcgtgttt cgtttggact ttctgacacc atga             774
//

If you have problems or comments...

PBIL Back to PBIL home page