(data stored in ACNUC7421 zone)

EMBL: CP000271.PE452

CP000271.PE452       Location/Qualifiers
FT   CDS_pept        528122..532933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2573"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2573"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33420"
FT                   /db_xref="GOA:Q13R69"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R69"
FT                   /protein_id="ABE33420.1"
FT                   /translation="MISVTPSSNWLGNARRRAAGTFAALLTVLLAAMTLAVSPAAYADD
FT                   DAASAAAAADANIAGNPTLQTAPSSNFSSQKVDGQPFFLLSDASFGSDQLAQVRLEAPG
FT                   RDFKDALQAYGGADIVVYRVPRPLDFLKAQKNLHRLNVAPNYQGEGLANTLTYLWDRWF
FT                   TEARRAWQRVLSFATRSKATEAAPQFKLGEQTGKQTQFEPSSQFAPLKGYDMVARFRYP
FT                   IWDAKVIQPPKGVNLAGSSSNFIEASAGNVMIPVGKLPPGLYIVEAVIGNYRAHTLLFV
FT                   SDTVAVVKAASSGMLVWTTRRDNGKPVANTEVSWTDGVGVLQSGATGGDGALVLQHVSP
FT                   ERSYVLGTDPQGGVFVSENFYYDSEIYNTKIYAVTDRPMYRPGDPVHVKFIGRTFQSAT
FT                   QSSAPAEADIRLDVLDPNGAPVASSKVHFASGTGADTAFTLPADATAGGYTLRFDYNGD
FT                   VYGSAFRVAEYVKPHFDVNLSMDKADYATGEALKGKIQLRYPDGKPVRDSKISVTLRAQ
FT                   KVTIVDGELRYAGLFPVKLDQQELKTDSDGNASLTLPAAKEPSRYALTLFAQDGAAYKV
FT                   RVTREVLIARGATPYRLNTAKSFSQPKDVVSFDLQALGAIDPASHAPSKYEWTRLESQT
FT                   HGEGALKSASAGGKLSFPVQFDEPGSYMLSVKDDLGNLLAATSHWVAGDGLKAIPGSVE
FT                   IVFDRDRYKIGDTAEALITFPMPVDDALLTLERDNVERRALLTAGGDWLQLQRVAPSQW
FT                   KARIKVGEDFAPNMTFSVLYVHAGEYVFQNAGIVVAQPQIELKVKSDKPVYGPGDTVTL
FT                   NLDSTLNGKPEAANLTVSVVDEMVYVLQPEIAPNIVDFFYHPRRNNVRTSSSLSFITYD
FT                   LARSPLKGAPGGPQRANYNERGVKVLERPRRDDQDTAAWEANLKTDANGHATMTFKMPD
FT                   SLARWRITVRAAAPDGMVGQRTAYVRSDKALYLKWSGPSHFRVNDQPAIDMIAFNQTDA
FT                   DMDAQWVVDGGGLSLNQKVTLKRGANYLRLPSGALKDGVINASLRSAGKDVDRLQTTIH
FT                   LDASGWLDLHQNTVALDGSNKPLSLPQDAQDVSVRFIGSAASQFMRVADDLIAYPYGCA
FT                   EQTSSRLIPLALAHDAIGRGVSGDGGASSAQGLEALLRNQRQRLAMLAGVGGTFGWWGD
FT                   TTGGSALITAYAYYADWLASRSLGISLPADNWQHAMDVYRDAGAKEPLLHRALALWLMQ
FT                   QMGLPVATPVSGVAADLMSDAAATASVPARNGTYGASDSIVFAQADSPRGKQMATLLIA
FT                   GMARSTSAQLPDGFDAAASAARAALSNDPAPLVQSLLVMSGGDGGAAADPSALLAKSSA
FT                   DYPTLDRALTLLWLRKALGGDVAATSLPSLQGAGWTRAATPTGTPLYRWTGATLPAALD
FT                   VGAARADVNALVSFRSHTSEDSRLNISVERRLYKLEPVEVAADPKKKDASAESQVGRAA
FT                   FTARLVKQGDAIDSNALYVDEVTLTPRSGNAYHYGLLDVPLPPGGDVEATSWGVSIDGL
FT                   PGAKEGASGPQPFQRVASYEMGELAYHQPVPLLDRPVTLRQLVRFALPGTFALPPARYF
FT                   RMYQPDAKAFEGGKSDHLTTLRIQ"
     atgatttccg tcacgccgtc gagcaactgg ttgggcaacg cgcgccgtcg cgcggcaggc        60
     acgttcgcgg cgctgctgac tgtcttgctc gcggcgatga cgctcgccgt ctcaccggct       120
     gcttacgcgg acgacgacgc agcgagcgcc gctgccgcag ccgatgccaa catcgccggc       180
     aatccaacgc tgcagacagc gccatcgagt aacttcagtt cgcagaaggt cgacggacag       240
     ccgttcttcc tgctttcgga cgcgagcttc ggcagcgatc aactggcaca ggtgcggctc       300
     gaagcgcccg gccgcgattt caaggacgcg ttgcaggcat atggcggcgc ggacatcgtc       360
     gtgtatcgcg tgccgaggcc gctagacttt ctgaaggcgc agaagaatct gcaccggctg       420
     aatgtcgcgc cgaattatca gggcgaaggg ctcgcgaata cgcttaccta tctgtgggac       480
     cggtggttta ccgaagcgcg ccgcgcatgg cagcgcgtgc tgtcgttcgc gacccgcagc       540
     aaggcgaccg aagcggcgcc gcaattcaag ctcggcgaac agaccggcaa gcagacgcaa       600
     ttcgagccga gttcgcaatt cgcgccactc aaaggctacg acatggtcgc gcgtttccgc       660
     tatccgatct gggacgcgaa agtgatccag ccgcccaagg gcgtgaatct ggcgggcagc       720
     agcagtaact ttatcgaagc cagtgcgggc aacgtaatga ttccggtcgg caagctgccg       780
     ccggggctgt atatcgtcga agcggtgatc ggcaactatc gtgcgcatac gctgctgttc       840
     gtgtcggaca cggtggcggt cgtgaaagcc gcgtcgagcg gcatgctggt atggaccaca       900
     cggcgcgata acggcaagcc ggtcgcgaat acggaagtga gctggaccga cggcgtgggc       960
     gttctgcaaa gcggcgcgac cggcggcgac ggcgcgctgg tgctgcaaca cgtgagcccc      1020
     gagcgcagct acgtgctcgg caccgatccg caaggcggcg tgttcgtctc cgagaatttc      1080
     tattacgaca gcgagatcta caacacgaag atctacgcgg tgaccgaccg gcccatgtac      1140
     cggccgggcg atccggtgca tgtgaagttc atcggccgca cgttccagag cgcgacgcaa      1200
     tcgtccgcgc ccgccgaggc cgatatcagg ctcgacgtgc tcgatccgaa cggcgcgccg      1260
     gtggcgagca gcaaggtgca tttcgcgtcg ggcacaggcg cggataccgc gttcacgctg      1320
     cccgccgacg ccaccgccgg cggctatacg ctgcgcttcg actacaacgg cgatgtatac      1380
     ggcagtgcat ttcgcgtcgc cgaatatgtg aaaccgcact tcgacgtgaa tctctcgatg      1440
     gataaagccg actacgcgac cggcgaggcg ctgaagggca agatccagtt gcgctatccg      1500
     gacggcaagc cggtgcgcga cagcaagatt tcggtcacgc tgcgcgcgca gaaagtgacg      1560
     atcgtcgacg gcgaattgcg ttatgcggga ctgttcccgg tcaagctcga ccagcaggaa      1620
     ctgaagacgg atagcgacgg caacgcgagc cttacgctgc cggccgcgaa agaaccgagc      1680
     cgctatgcgt tgacgctgtt cgcgcaggac ggcgccgcat acaaggtgcg cgtgacgcgc      1740
     gaagtgctga tcgcgcgcgg cgcgacgccg tatcgtttga acacggccaa gtcgttctcg      1800
     caaccgaagg acgtggtgag cttcgactta caggcgctcg gcgcaatcga tcctgcgtcg      1860
     cacgcgccgt cgaagtacga atggacgcgc ctcgaatcgc aaacgcatgg cgaaggcgca      1920
     ttgaaaagcg cgagcgcggg cggcaagctg tcgttcccgg tgcaattcga cgaaccgggt      1980
     tcgtacatgc tgtcggtcaa agatgatttg ggcaatctgc tcgccgccac tagccattgg      2040
     gttgcgggcg atggcctgaa ggcgattccg ggcagcgtcg agatcgtgtt cgatcgcgac      2100
     agatacaaaa tcggcgacac cgctgaagcg ctgatcacct tccccatgcc ggtcgacgac      2160
     gcgctgctca cgctcgaacg cgacaacgtc gaacgtcgcg ctctgctgac ggctggcggc      2220
     gactggttgc aactgcaacg ggtggcgccg tcgcaatgga aagcgcggat caaggtgggt      2280
     gaagacttcg cgccgaacat gacgttctcg gtgttgtacg tacacgccgg cgaatacgtg      2340
     ttccagaacg cgggcatcgt ggtcgctcaa ccgcagatcg aactgaaagt gaagagcgac      2400
     aagccggtgt acggaccggg cgacacggtc acgctgaatt tagacagcac gctgaacggc      2460
     aagccggaag cggcgaatct gacggtgagt gtggtcgacg agatggtcta cgtgttgcag      2520
     ccggaaatcg cgccgaatat cgtcgacttc ttctatcacc cgcgccgcaa caacgtgcgg      2580
     acttcgtcga gcctgtcgtt cattacctac gacctcgcac gctcgccgct gaaaggcgcg      2640
     ccgggcggac cgcagcgcgc gaactacaac gagcgtggcg tgaaggtgct cgaacggcca      2700
     cgccgcgacg atcaggacac ggcagcgtgg gaagccaacc tgaaaaccga cgcgaacggc      2760
     cacgccacca tgacgttcaa gatgccggat tcgctggcgc gctggcgcat taccgtgcgc      2820
     gctgcggcgc cggatggcat ggttggccaa cgcaccgctt acgtgcgctc ggacaaggcg      2880
     ctgtatctga agtggagcgg gccatcgcat ttccgcgtca acgatcagcc cgccatcgac      2940
     atgatcgcgt tcaatcagac cgacgcggat atggacgcgc agtgggtggt ggacggcggc      3000
     gggttgtcgc tcaatcagaa ggtcacgctc aagcgcggcg cgaactatct gcgtctgccg      3060
     agcggcgcgc tgaaggacgg cgtgatcaac gcgtcgctgc gcagcgcggg taaggacgtc      3120
     gatcgtctgc aaaccacgat tcatctcgac gcgagcggct ggctcgatct gcatcagaac      3180
     acggtggcgc tcgacggctc gaacaagccg ctcagtctgc cgcaagacgc gcaggacgtc      3240
     agcgtgcgtt tcatcggcag cgcggcgagc cagttcatgc gtgtcgccga cgatctgatc      3300
     gcctatccgt acggttgcgc cgagcagacg tcgagccgcc tgattccgct ggcgctcgcg      3360
     catgatgcga tcggccgcgg cgtctccggt gacggcggcg cgagttcggc gcaaggcctc      3420
     gaagcgctgc tgcgcaatca gcggcagcgt ctggccatgc tggcgggtgt cggcggcacg      3480
     ttcggctggt ggggcgatac cacgggcggc agcgcactga ttacggccta cgcgtattac      3540
     gcggactggc tcgcgagccg cagcctcggc atcagcctgc ccgccgacaa ctggcagcat      3600
     gcaatggacg tctatcgcga cgccggcgcg aaagagccgc tgctgcatcg cgcgctggcc      3660
     ttgtggctga tgcagcagat gggcctgccg gttgcgacgc cggtctcggg cgtggccgcg      3720
     gacctgatga gcgacgcggc ggccacggcc agcgtgcccg cacgcaacgg cacgtatggc      3780
     gcgtcggaca gcatcgtctt tgcgcaagcc gattcgccgc gcggcaagca gatggcgacg      3840
     ctgctgatcg ccggcatggc gcgcagcacg agtgctcaat tgcccgatgg gttcgatgcg      3900
     gcggcgagcg ccgcgcgcgc ggcattgagc aacgatcctg cgccgctcgt gcaaagcctg      3960
     ctggtcatgt cgggtggcga cggcggcgcg gcagccgatc catcggcctt gctcgcgaag      4020
     agcagcgccg attacccgac gctcgatcgc gcgctcacgc tcctgtggtt acgcaaggcg      4080
     ctgggcggcg atgtggcggc cacgtcgttg ccgtcgctgc aaggcgcggg ctggacacgc      4140
     gccgcgacgc ccaccggcac gccgctttac aggtggaccg gcgccacgct gccggccgcg      4200
     ctcgacgtcg gcgccgcccg cgccgacgtc aacgcgctgg tctcgttccg cagtcatacg      4260
     agcgaggaca gccgtctgaa tatcagcgtc gagcgccgcc tctacaagct cgaaccggtc      4320
     gaggtcgcgg ccgatccgaa gaaaaaggat gcctcggccg agagccaggt ggggcgcgcc      4380
     gcgttcaccg cgcgtctggt gaagcagggc gatgcgatcg acagcaacgc gctttacgtc      4440
     gacgaagtca cgctcacgcc gcgctcgggc aacgcttacc actatggctt gctcgacgtg      4500
     ccgctgccgc cgggcggcga tgtcgaggcg acgagctggg gcgtgtcgat cgacggtctg      4560
     ccgggcgcga aagagggcgc cagcggtccg cagccgttcc agcgcgttgc gtcgtacgag      4620
     atgggtgagc tggcgtatca ccagcccgtg ccgttgctcg accggccggt cacgctgcgg      4680
     caactggtgc gcttcgcgtt gccgggcacg ttcgcgttgc cgcccgcgcg ctacttccgc      4740
     atgtatcagc cggacgcgaa ggcgttcgaa ggcggcaaga gcgatcacct gacgacgttg      4800
     cgcatccagt aa                                                          4812
//

If you have problems or comments...

PBIL Back to PBIL home page