(data stored in ACNUC7421 zone)

EMBL: CP000271.PE453

CP000271.PE453       Location/Qualifiers
FT   CDS_pept        533100..534728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2572"
FT                   /product="Signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2572"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33421"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR018748"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R68"
FT                   /protein_id="ABE33421.1"
FT                   /translation="MLRFAWLRDGRSQLWQVDGSGAAVGFSPQAAGALPRTLQTPLGSV
FT                   WKLFVYGYLVDRNVTTPDYACNGGDPEEVYCCMTGGHIDREHALVQSCGLFFEPARLQL
FT                   DSADWRKYWTAAHAPAWLRDLHTMTPAHRVPVTELLAALQAMPARPREAAASTLVSVLT
FT                   SGRGEGTVSLYGSVLRAKTWTMPDPARPGASIGGAAGWLADGTPVWLGGSGGSARVLTA
FT                   AAPRLAPLLAQISVPDDAACVLIDFFSRYPIREVVGDKGPAAAPKGPLRGNFRVGFVNG
FT                   NWARVTSRGELRLDRDAAGAPHVVGRFGMNDYVARVVEREGDTSEPEAAKALAVAARTY
FT                   VVQHGNHDHGCFRIDDSSSTQRVLPRAPTAAARHAADLTDALVLTGAPVQYHHDEAAPG
FT                   QMSWLAAKASAQTGLTFDAILARTWPQATLTSFQSPLSGDCIAVAGAQAWLQRNAPLWA
FT                   RRMDGAAGYETPDLPAVCAVREGRPYADAQRNRVYVYRLQTEEDRIALAHEYVHLAFQH
FT                   HPRGLDETFVERTARTLIRTDNPIQ"
     atgctgcgct ttgcctggtt gcgcgacggc cggagccagc tttggcaagt cgacggcagc        60
     ggcgccgcgg tcggcttttc gccgcaggcg gcgggcgcgt tgccgcgcac gcttcagacg       120
     ccgctcggca gcgtgtggaa actgttcgtc tacggttatc tggtggaccg caacgtcact       180
     acaccggatt acgcctgcaa cggcggcgac ccggaggaag tgtattgctg catgaccggc       240
     ggtcacatcg atcgcgaaca tgcgctggtg cagtcgtgcg gactcttttt cgagcccgcg       300
     cgcctgcaac tcgattccgc cgactggcgc aagtactgga cggccgctca cgcgccagcc       360
     tggctacgcg atctgcacac catgaccccg gcgcaccgcg tgccggtaac cgaactgctc       420
     gccgcgttgc aggccatgcc cgcccggccg cgcgaagcgg ccgccagcac gctcgtgtcg       480
     gtgctgacca gcggacgcgg tgaaggcacg gtgtcgctct acggcagtgt gctgcgcgcc       540
     aaaacctgga cgatgccgga tccggcgcgg ccgggcgcgt cgatcggcgg cgcggcgggc       600
     tggctcgccg acggcacgcc ggtgtggctg ggcggttcgg gcggcagcgc acgcgtgctg       660
     acggccgccg cgccgcgcct cgcgccgctg ctcgcgcaaa tctccgtgcc cgacgacgcc       720
     gcctgcgtac tgatcgattt cttcagccgc tatccgattc gcgaggtggt cggcgacaaa       780
     gggccggccg ccgcacccaa ggggccgttg cgtggcaatt tccgggtcgg cttcgtgaac       840
     ggcaattggg cgcgggtgac gagccgcggc gaattgcggc tcgatcgcga cgcggccggc       900
     gcgccgcacg tggtcggccg tttcggtatg aacgactacg tggcgcgcgt ggtcgagcgc       960
     gaaggcgaca cgagcgagcc ggaagcggcc aaggcgctgg ctgtcgcggc gcggacctac      1020
     gtcgtgcagc atggcaacca cgatcacggc tgttttcgta tcgacgacag cagcagcacg      1080
     cagcgcgtcc tgccgcgcgc gccgacggca gccgcgcgcc atgccgccga cctgaccgac      1140
     gcgctcgtgc tgaccggcgc gcccgttcag tatcaccacg acgaggccgc gccgggacag      1200
     atgagctggc tggccgcgaa ggcctccgcg caaaccggcc tgacgttcga cgccattctc      1260
     gcccgcacct ggccgcaagc gacgctgacg tcgttccaga gtccgttatc gggcgactgc      1320
     atcgcggtgg ccggcgcgca ggcatggctg cagcgcaacg cgccgttgtg ggcgcggcgc      1380
     atggacggcg cggcgggcta cgaaacgccc gatctgcccg ctgtctgcgc ggtgcgtgaa      1440
     gggcgtccgt atgccgatgc gcagcgtaat cgcgtgtatg tgtaccgctt gcagactgaa      1500
     gaggaccgca tcgcgttggc gcatgaatat gttcacctcg cgttccagca tcacccgcgt      1560
     ggtctcgatg agacgttcgt cgagcggacc gcgcgcacgc tgattcgcac cgacaatcca      1620
     atccaatga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page