(data stored in ACNUC7421 zone)

EMBL: CP000271.PE454

CP000271.PE454       Location/Qualifiers
FT   CDS_pept        534899..535711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2571"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2571"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33422"
FT                   /db_xref="InterPro:IPR012039"
FT                   /db_xref="InterPro:IPR019220"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R67"
FT                   /protein_id="ABE33422.1"
FT                   /translation="MKMKVKTTGWTKASHRFLAVACLAGLQAAPAAYASDIDFAAPLNG
FT                   WRNTSGDSERYTQDVHYPAVSVSTPEGQSRFALIEGQIRNAPKKKGTTVGTLVVDGTPL
FT                   PQRVEEDGKFSRPYAFPAGSNGVELRAPDGSRKRVQFYDAYSGKTQPKLRVLLAWDTDG
FT                   TDLDLHVVSPDGAHTWYGERVAPNGGALDVDVTTGYGPEIYSSAAPLKGTYLVYVNYYG
FT                   SGNSGADMTVAQVTIITNENTPNEKSETIRVPMRKAGELTLVKTFVLP"
     atgaagatga aggtcaagac cacgggttgg acgaaggcga gccacagatt ccttgcagtg        60
     gcctgtttgg ccggcctgca ggccgcgccg gcggcgtacg cgagcgacat cgacttcgcc       120
     gcgccgttga acggctggcg caacacgagc ggcgacagtg agcgttatac gcaggacgtg       180
     cactacccgg cggtgtcggt atcgacgccg gaagggcagt ccagattcgc gctgatcgaa       240
     gggcagattc gcaacgcacc gaagaagaaa ggcactacag tgggcacgct ggtggtcgac       300
     ggcacgccgt tgccgcagcg cgtggaagag gacggcaagt tctcgcggcc ttacgcgttt       360
     cctgcgggca gtaacggcgt ggaactgcgc gcgccggacg gcagccgcaa gcgcgtgcag       420
     ttctacgacg cctacagcgg taagacccag ccgaagctgc gcgtgctgct cgcgtgggat       480
     accgacggca ccgatctgga tctgcacgtc gtgtcgcctg acggcgcgca tacctggtat       540
     ggcgagcgcg ttgcaccgaa cggcggcgcg ctcgacgtcg acgtgacgac cggctatggg       600
     ccggagattt attcgtccgc ggcgccgttg aagggcacct atctggtcta tgtgaactac       660
     tacggtagcg gcaatagcgg tgccgatatg accgtcgccc aggtgaccat catcacgaac       720
     gagaacacgc cgaacgaaaa gagcgaaacg attcgtgtgc cgatgcgcaa ggcgggtgaa       780
     ttgacactcg taaaaacgtt cgtgctgccg taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page