(data stored in ACNUC7421 zone)

EMBL: CP000271.PE455

CP000271.PE455       Location/Qualifiers
FT   CDS_pept        complement(536002..536478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2570"
FT                   /product="Conserved hypothetical protein"
FT                   /note="PRC-barrel domain present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2570"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33423"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R66"
FT                   /protein_id="ABE33423.1"
FT                   /translation="MTTFNPQVPASAGAQGANIVGVGMGDGPGPDVMAASTLDGNKVMS
FT                   SDGEHVGKISDIMLDVRGGRIAYAVLSTGGFLGMGDTLHAIPWSALTLDTDDRCFVLDA
FT                   SADRIKNAPGFDKDNWPLMADTQWGTAVHEYYNRPPYWSATRGAVEERDVDSDL"
     atgactacgt tcaatcccca agtcccggca tccgccggcg cgcagggcgc aaatattgtt        60
     ggagtcggca tgggtgacgg tcccggaccg gacgtcatgg cggcatccac gctcgatgga       120
     aacaaggtga tgtcgtccga cggcgagcat gtcggcaaaa tctccgacat catgctcgac       180
     gtacgcggcg ggcggatcgc ctacgcggta ttgtccaccg ggggttttct cggcatgggc       240
     gacacgctgc acgccatacc gtggagcgcg ctcacgctcg acacggacga caggtgcttc       300
     gtgctcgatg caagcgctga caggatcaag aatgcgccgg gcttcgataa ggataactgg       360
     cctttaatgg cggatacgca atggggcacg gccgtgcacg agtactacaa ccgtccgccg       420
     tactggtcgg ccacgcgcgg cgcggtggaa gagcgagacg tggactccga tctttga          477
//

If you have problems or comments...

PBIL Back to PBIL home page