(data stored in ACNUC7421 zone)

EMBL: CP000271.PE456

CP000271.PE456       Location/Qualifiers
FT   CDS_pept        complement(536715..538712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2569"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2569"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33424"
FT                   /db_xref="GOA:Q13R65"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R65"
FT                   /protein_id="ABE33424.1"
FT                   /translation="MNPFDREDSQHETAGYAAKAPSGRTAKGKGAGKAIPVAAELPPQQ
FT                   AEERQRQMRALIQLGKEQGYLTHAQINDHLPDNFAQTAAIDSIVSAFNDMGVQVYEQAP
FT                   DAETLLLNSNAPAVVSDDQADEETEVALSTVDSEFGRTTDPVRMYMREMGATELLTRAG
FT                   EIAIAKRIEDGLHEMVQAIAACPLAISAILASAQQVADGELRIDELVDGLNEDTIAAEE
FT                   DSASAEASAEVDADTDGDEDEDSDDDVGPADSSAADEARLKQLTSDCLEIFAQVGMLSD
FT                   QMNASHTRGDVTSKAYQRAREEIQQHLAKIRFTARTIDRLCGDVQQQVAQVRAIERNIL
FT                   QIVVSKSGMPREKFIESFAGHEADLGWTERAARGASAYGAALERHLPAIQSEQQKLIEI
FT                   EATVSLPLKHLKEINRQMVAAESKMRKAKSEMIEANLRLVISIAKKYVNRGMLFLDLIQ
FT                   EGNIGLMKAVDKFEYRRGWKFSTYATWWVRQAVTRSLADQARTIRVPVHMIETINKLNR
FT                   ISREILQQTGQEAHPSVLAERMELSEEKVRGILKIAKQPVSMETPVGDDGDATLGDMIE
FT                   DSAASSPADAAMQADLRAAIDDALDSLSPREAKVLRMRYGINTKSDHTLEEVGKQFDVT
FT                   RERIRQIESKAMRKLMHPSRADRLKSFLDR"
     gtgaaccctt ttgatcgcga agattcgcaa cacgaaaccg ccggctacgc cgccaaagct        60
     ccctcgggcc gcacggccaa gggcaagggc gccggcaaag cgatccccgt ggcggccgaa       120
     ctgccgccgc agcaagctga ggaacgtcag cgccagatgc gtgcgctgat ccagttgggc       180
     aaggaacagg gttatcttac ccacgcgcag atcaacgacc atctgcccga caacttcgcg       240
     caaacggccg cgatcgacag tattgtcagc gcgttcaacg acatgggcgt gcaggtctac       300
     gagcaggcgc cggacgcaga aacgctgctg ctcaactcga acgcccctgc cgtggtgtcg       360
     gacgatcagg cagacgagga aaccgaagtc gccctgtcga ccgtcgattc cgaattcggc       420
     cgcacaaccg accccgtgcg catgtacatg cgcgaaatgg gcgcgaccga actgctgacg       480
     cgcgccggcg aaatcgcgat tgccaagcgc atcgaagacg gcctgcacga aatggtgcag       540
     gcaatcgctg cttgcccgct cgcgatctcg gcgattctgg cgagcgccca acaggttgcc       600
     gacggcgagc tgcgcatcga cgaactggtc gacggcctca atgaagacac gatcgccgcc       660
     gaagaagaca gcgcaagcgc ggaagcatcg gccgaagtcg acgcggacac ggacggcgac       720
     gaggacgaag acagcgacga cgacgtcggc cccgctgact cgtcggcagc agacgaagca       780
     cgcctgaagc agctcacgag cgactgcctc gaaatcttcg cgcaagtcgg catgctgtcc       840
     gaccagatga acgcctcgca cacgcgcggc gacgtcacct cgaaggcgta tcagcgcgcg       900
     cgcgaagaga tccagcagca cctcgcgaag atccgcttca cggcacgcac catcgaccgc       960
     ctgtgcggcg acgtgcagca acaggtcgcg caagttcgtg cgatcgagcg caacattctg      1020
     caaatcgttg tttcgaagag cggcatgccg cgcgagaagt tcatcgagtc gttcgccggt      1080
     catgaagccg acctcggctg gacggaacgt gcggcgcgcg gtgcgtccgc ctacggcgcg      1140
     gcgctggagc gccatttgcc ggccattcag tccgaacagc aaaagctgat cgaaatcgaa      1200
     gccacggttt cgctgccgct gaagcatctg aaagaaatca accgccagat ggtcgcggcc      1260
     gaatcgaaga tgcgcaaggc gaagagcgag atgatcgagg cgaatctgcg tctcgtgatc      1320
     tcgatcgcga agaagtatgt gaatcgcggc atgctgttcc tcgacctgat ccaggaaggc      1380
     aacatcggct tgatgaaggc cgtggacaag ttcgaatacc gccgcggctg gaagttctcc      1440
     acgtacgcaa cgtggtgggt ccgccaggct gtcacgcgtt cgcttgcgga tcaggctcgc      1500
     acgatccgcg tgccggtgca catgatcgaa acgatcaaca agctgaaccg catttcgcgc      1560
     gaaatcctgc agcagaccgg tcaggaagcg catccgtccg tgctcgcgga acgcatggaa      1620
     ctctcggaag agaaagtgcg cggcattctg aagatcgcca agcagccggt gtcgatggaa      1680
     acgccggttg gcgacgacgg cgatgccaca ctcggcgaca tgatcgaaga ctcggcagct      1740
     tcttcgccgg ccgacgcggc catgcaggcc gacttgcgcg ccgccatcga cgacgcgctc      1800
     gactcgctgt cgccgcgcga agccaaagtg ctgcgcatgc gttacggcat caacacgaag      1860
     tcggaccata cgctcgaaga agtcggcaag cagttcgacg ttacgcgtga gcggattcgt      1920
     cagatcgaga gcaaggccat gcgcaagctg atgcatccga gccgcgccga tcgtctgaag      1980
     tcgttcctcg accgctaa                                                    1998
//

If you have problems or comments...

PBIL Back to PBIL home page