(data stored in ACNUC7421 zone)

EMBL: CP000271.PE457

CP000271.PE457       Location/Qualifiers
FT   CDS_pept        complement(545155..545556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2568"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2568"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33425"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R64"
FT                   /protein_id="ABE33425.1"
FT                   /translation="MLLPIARQTADDLALRVHLALDALRRGAGSMTDAQTLTQVMLLTG
FT                   FLAESGFGSATGEQLSAAERAVSAVFDIGRETGKWRLDEAGFSLFAMIATNYDRQLHSA
FT                   PLWAITDASERLDRFTAGMSYQTPVRKRA"
     atgctgctac cgatcgcccg gcagaccgcc gacgacctcg cactacgggt ccatctggca        60
     ctcgacgcct tgcgccgcgg cgccggcagc atgaccgacg cacaaacact cacgcaagtc       120
     atgctgttga ctggctttct ggctgagtcg ggcttcggct cggcgactgg cgagcagttg       180
     agtgcggcag aacgcgcggt gtcggccgtg ttcgatatcg gccgtgagac cggcaagtgg       240
     cgtttggacg aggcgggatt ctcgcttttt gcgatgatcg cgacgaacta cgatcggcag       300
     ttgcatagcg cgcccctttg ggccatcaca gatgcaagtg agcgacttga tcgatttacc       360
     gcaggcatgt cgtatcagac tccagtgcgt aagcgagcct ag                          402
//

If you have problems or comments...

PBIL Back to PBIL home page