(data stored in ACNUC7421 zone)

EMBL: CP000271.PE459

CP000271.PE459       Location/Qualifiers
FT   CDS_pept        547193..548386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2566"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2566"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33427"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R62"
FT                   /protein_id="ABE33427.1"
FT                   /translation="MLKLAALSAVPGTLGSLVARSAFAQAGTLQFACPVPMSGPFAANG
FT                   KYADLGMKLAIEQYGKVLGQPLAYTVLDTEGKPATAVRRVQEIAQQKNARFFAGGILSS
FT                   EALAMGKEVQKAGGIFITTAGADEITGKDCNDATFRWSVPTYGAIEQTVRPLIQTLPKA
FT                   KRWYTITPQYVFGDGLLSAAKAIFKEKGIEHVGNSYHSLNEKEFSGYLTNAVAAKPDVL
FT                   LILNFGSQSSDTLRQAVSFGMKNNCTILMAWASGLEQFESLGADLCEGVYFGAQYWHDI
FT                   DSPLNRDLVKRTNAAFKANPNYSLAGSYICTKILLDGIVKAGNVDPKKVIAALEGMKYD
FT                   GLTGPEEVRKGDHQVLKNYYLLKGKAKNKMKNADDYADIVSSGQSFLPLDKTGCKMV"
     atgttgaagc tggccgcgtt gtcggccgtt ccggggacgt tgggttcgct ggtcgcgcga        60
     agcgcgttcg cgcaggccgg caccttgcag ttcgcctgtc cggtgccgat gtccggtccg       120
     ttcgcggcga acggaaaata cgccgacctc ggcatgaagc tcgctatcga gcagtacggc       180
     aaggtgctgg gccaaccgct cgcatacacg gtgctcgaca cggaaggcaa gccggcaacc       240
     gcagtgcgcc gtgttcagga aatcgcgcag cagaagaatg cacgcttctt tgcgggcggt       300
     attctgtcct ccgaagcatt ggcaatgggc aaggaagtgc agaaagccgg cggcattttc       360
     atcactacgg cgggcgcgga tgaaatcacc ggcaaggact gcaacgacgc cacgttccgc       420
     tggtcggtgc cgacctatgg cgcgatcgag caaacggtgc gtccgctgat ccagacgctg       480
     cccaaggcga aacgctggta caccatcacg ccgcaatacg tgttcggcga cggcttgctg       540
     tcggccgcca aggcgatctt caaagagaag ggtatcgagc acgtgggcaa cagctaccac       600
     tcgctcaatg agaaggagtt cagcggctat ctgacgaatg cagttgcagc aaagcctgac       660
     gttctgctta ttctgaactt cggctcgcag tcgtccgata cgttgcgcca ggccgtgagc       720
     tttggcatga agaacaactg cacgattctg atggcgtggg cgtccggact cgagcaattc       780
     gaatcgcttg gcgcggatct ttgcgaaggc gtctatttcg gcgcgcagta ttggcacgac       840
     atcgattcgc cgctcaaccg cgatcttgtc aaacgcacga acgccgcatt caaggcgaac       900
     cccaactaca gcctggcggg ctcctatatc tgcacgaaga tcctgctgga cggcatcgtg       960
     aaagcgggca atgtcgatcc gaagaaagta atcgcagcac tcgaaggcat gaaatacgac      1020
     ggtttgactg gtccggagga ggttcgcaaa ggcgaccacc aggtactgaa gaactattat      1080
     ctgttgaagg gtaaggcgaa gaacaagatg aaaaacgccg acgactacgc ggatatcgtg      1140
     agttccggtc aatcgttcct gccgctcgac aagaccggct gcaagatggt ttga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page