(data stored in ACNUC7421 zone)

EMBL: CP000271.PE460

CP000271.PE460       Location/Qualifiers
FT   CDS_pept        548485..549345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2565"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33428"
FT                   /db_xref="GOA:Q13R61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R61"
FT                   /protein_id="ABE33428.1"
FT                   /translation="MNVYLLQIVNGIGVGMLYFLLAVGLSIVFGLLRFVNFAHGAFYLL
FT                   GAYFCYQAMQWSMSFWTALVVVPIVVGALAWVVEKLILRHVYAQQHEFHILVTVGLALV
FT                   VQECAILIWGPLGDNVAVPDMLNGVVIWGSFVYPKYRLFVIGFTAVLAALLWWVLEGTR
FT                   LGSAVRAGSESTEMVSLLGINVLRVFSLVFALGAATAALAGVLAAPIRGVDPFMGIEAL
FT                   SVAFVVVVVGGMGNFLGALVGGLLVGIVQSVMSTLWPEGARLMIYVAMAAVLLLRPNGL
FT                   LGRAA"
     atgaacgttt atcttctgca gatcgtcaac ggcatcggag tggggatgct gtatttcctg        60
     ctcgcggtcg ggttgtcgat cgtgttcggc cttctgcgct tcgtgaattt cgcgcacggt       120
     gcgttctatc tgctcggcgc gtacttctgc tatcaggcga tgcagtggtc gatgagtttc       180
     tggaccgcgc tcgtggtggt gccgattgtc gtgggcgcgc ttgcatgggt cgtcgagaaa       240
     ctgattctgc ggcacgtgta cgcgcagcag catgagttcc atattctcgt gacggtcggt       300
     ctcgcgctcg tggtgcagga atgcgcgatc ctgatctggg gaccgctagg cgataacgta       360
     gccgtgcccg acatgctgaa cggcgtggtg atctggggca gcttcgtgta tccgaaatat       420
     cgtctcttcg tgatcggctt cacggcggta ttggcggcgc tcttgtggtg ggtgctggaa       480
     ggcacgcggc taggcagcgc ggtgcgcgcg ggcagtgaat cgacggagat ggtctcgctg       540
     ctcggcatca acgtattgcg tgttttcagc ctcgtattcg cactcggcgc tgcaacggcc       600
     gcgttggcgg gcgtgcttgc cgcgccgatt cgcggcgtcg atcctttcat gggcattgaa       660
     gcgctcagcg tcgcattcgt cgtggtggtg gtcggcggca tgggtaattt cctcggcgcg       720
     ctggtcggcg gactgctggt ggggatcgtg caaagcgtca tgagtacctt gtggccggag       780
     ggcgcgcgac tcatgatcta cgtcgcgatg gcggccgttc tgttgctgcg gccgaacggt       840
     ttgctcggga gggcggcatg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page