(data stored in ACNUC7421 zone)

EMBL: CP000271.PE461

CP000271.PE461       Location/Qualifiers
FT   CDS_pept        549342..550409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2564"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2564"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33429"
FT                   /db_xref="GOA:Q13R60"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R60"
FT                   /protein_id="ABE33429.1"
FT                   /translation="MIDTSKPIAQSASSVRAQPGLKHSLHRYRFLLLALLVVCVLPLTL
FT                   RSGSLATEVLVFALAALGCNLLLGYTGLLSFGQGIFFGLGSYCAGLVLTRTALPVPAAL
FT                   FAAAIIGAAAAALVGWFSIRQRGTYFVMLTLAFGQLFYFLAYTTPDLTGGDNGLLDIPR
FT                   PALGLFGKTIVPLTSPWQYYGFVAVLFLVVFWLLMRVSHSVFGRTLLAIRDNEARAAAV
FT                   GYDVKRFKLMAFVISGAVTGLAGALHALMTGIAPLSNIDYHTSEMILVMTVIGGTGNLF
FT                   ASVLGAAFYVLFADWLSTLWPRWLLLLGIVLIAVSLFMQRGLWGLGERIWQSLRRRSST
FT                   DAGNGADNDADKEPI"
     atgatcgata cctcgaagcc catcgcgcaa agtgcttctt ctgtaagggc ccagccgggc        60
     ctgaagcatt cgctgcatcg ctatcgcttc ctgctgcttg cgctgctagt ggtgtgcgta       120
     ttgccgctga cactgcgctc cggatcgctg gccacggaag tgctggtgtt cgcgctcgcc       180
     gcgctcggct gcaatctgct gctcggctac acagggctgc tttcattcgg gcagggcatt       240
     ttcttcggac taggcagcta ttgcgcggga ctggttctca ccaggacggc gttgccggtg       300
     cccgcggcgt tgtttgcagc ggcgataatc ggcgcggcgg ctgcggcgct cgtcggctgg       360
     ttttcgattc gtcagcgtgg cacgtacttc gtcatgctga cactcgcgtt cgggcaactg       420
     ttctatttcc tcgcgtacac cacgcccgat ctgaccggcg gtgacaatgg gttgctcgac       480
     attccgcgcc cggcgctcgg actgttcggc aaaacgatcg tgccgttgac ctcgccgtgg       540
     caatactacg gcttcgtcgc cgtgctgttt ctcgtggtgt tctggctgct gatgcgcgta       600
     tcgcactcag tattcggccg tacgttgctg gcgattcgcg acaacgaggc acgcgcggcc       660
     gcggtcggct acgacgtcaa acgcttcaaa ctgatggcgt tcgtgatctc cggcgcggtc       720
     acggggctgg cgggggcgct gcatgcgctg atgacgggca tcgcgccgct ctccaacatc       780
     gactatcaca cgagcgagat gatcctcgtg atgaccgtga tcggcggcac gggcaatctg       840
     ttcgcatccg tactaggcgc cgcgttctac gtgctgttcg ccgactggct ctccaccttg       900
     tggccgcgct ggctgttgct gctcggcatc gtactgatcg ctgtcagcct gttcatgcag       960
     cgcgggctgt ggggactggg cgaacgcatc tggcaatcgc ttcgccgcag atcgtctacc      1020
     gacgcaggca acggcgcaga caacgacgca gacaaggagc ccatatga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page