(data stored in ACNUC7421 zone)

EMBL: CP000271.PE462

CP000271.PE462       Location/Qualifiers
FT   CDS_pept        550406..551173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2563"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2563"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33430"
FT                   /db_xref="GOA:Q13R59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R59"
FT                   /protein_id="ABE33430.1"
FT                   /translation="MSEAILRASGVVKRYGKFTALADVTLNIMPRTVHSVIGPNGAGKT
FT                   TLFHVLTGTLPITEGKIVFDGHDVTHEPDHKRVRRGVARSFQVTSLFANLSVRENLRLA
FT                   AQGVDAVRALNAWAPPHGALTHSDTVDSVLERLALQRFSEVSAGALSHGQQRRLEVGMA
FT                   LAARPKAIFLDEPTSGMGIDDLDDMKQLIRGLRDDYTVVLIEHNMGIVMDISDTITVMQ
FT                   QGRVLVEGRPDDIRGDERVRSAYLGNMITGGRA"
     atgagcgaag cgattctgcg agcgagtggc gttgtaaagc gctatggaaa attcacggca        60
     cttgctgacg tcacgctcaa catcatgccg cgcacggtgc actccgtcat cggtcccaat       120
     ggggcgggca aaaccacgtt gtttcacgta ttgacgggca cgctgccgat caccgaaggc       180
     aagatcgttt tcgacggcca cgacgtcacg catgagccgg accacaagcg cgtacgacgc       240
     ggcgtagcgc gttcgttcca ggtaacgagc ctgttcgcca atctgagcgt gcgggaaaat       300
     ctgcggctcg ccgcgcaagg tgtcgacgcg gtgcgcgcgc tgaatgcgtg ggcgccgccg       360
     cacggtgcgc tcacgcattc ggataccgtc gatagcgtgc tcgaacggct ggcgttgcag       420
     cgtttcagcg aagtatcggc gggcgcgctc tcgcacggtc agcagcggcg gctcgaagtc       480
     ggcatggcgc tcgccgcgcg gcccaaggcc atctttctgg acgagccgac ctcgggtatg       540
     ggtatcgacg acctcgacga tatgaagcaa ctgatccgtg gcctgcgcga cgattacaca       600
     gtcgtgctga tcgaacacaa catgggcatc gtgatggaca tttccgacac gatcaccgtc       660
     atgcagcaag ggcgcgtgct agtggaaggg cgcccggacg acattcgcgg cgacgagcgc       720
     gtgcgcagcg cctatctcgg caacatgatc accggaggcc gcgcatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page