(data stored in ACNUC7421 zone)

EMBL: CP000271.PE463

CP000271.PE463       Location/Qualifiers
FT   CDS_pept        551170..551871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2562"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2562"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33431"
FT                   /db_xref="GOA:Q13R58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R58"
FT                   /protein_id="ABE33431.1"
FT                   /translation="MILDVQQIHGFYGKSHILQGVSLQINEGETVTLLGRNGAGKSTTL
FT                   KAIAGVVAPQRGTVTFNGAEIGGLPPHKIASRGVCFVPEHRGIFRLLTVEENLRLGARK
FT                   DSPWQLGDIYRIFPRLQERRTNGGAQLSGGEQQMLAIGRALMNHPRLLMLDEPVEGLAP
FT                   VIVEEIVAQLKLIREAGVAILLVEQNLEVCTQLADRHYIIEQGVIVYSGDNASFSADDS
FT                   IKDRYLGVGVV"
     atgattctcg acgtgcagca gattcacggc ttctacggca agagccacat cctgcaaggc        60
     gtgtccctgc aaatcaacga gggtgaaacg gtgacgctgc tgggccgcaa cggcgctggc       120
     aagtcgacca cgctgaaggc gattgccggt gtcgtcgcgc cacagcgcgg cacggtcacg       180
     ttcaacggcg ccgaaatcgg cggcttgccg ccgcacaaga tcgcgtcacg aggtgtgtgt       240
     ttcgtgccgg agcatcgcgg catctttcgt ttgctcacgg tcgaagagaa tttgcggctc       300
     ggcgcgcgca aagattcgcc gtggcaactg ggcgacatct accgcatttt tccgcgtctc       360
     caggagcggc gcacgaacgg gggcgcgcag ctatccggcg gcgaacagca gatgcttgca       420
     atcggccgcg cgttgatgaa tcacccgcgt ttgctgatgc tagacgagcc ggtggaaggt       480
     cttgcgccgg tgatcgtcga agaaatcgtc gcgcaactca agctgatccg cgaggcgggc       540
     gtggcgattc tgctggtcga gcagaacctc gaagtttgca cgcaactcgc ggaccgccac       600
     tacatcatcg aacagggcgt gatcgtgtat tccggcgata acgcgtcgtt ctccgcggac       660
     gactcgatca aggaccgtta tctcggcgtc ggcgtggtct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page