(data stored in ACNUC7421 zone)

EMBL: CP000271.PE468

CP000271.PE468       Location/Qualifiers
FT   CDS_pept        complement(557050..558105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2557"
FT                   /product="conserved hypothetical membrane protein,
FT                   YraQ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2557"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33436"
FT                   /db_xref="GOA:Q13R53"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R53"
FT                   /protein_id="ABE33436.1"
FT                   /translation="MQSTLRQPRVALGWIVFLLIAVVGLFYVKWFPYYNRAFVAASQHS
FT                   IGKSILMGTSASAPAASWQAAIDYALAYGKAIWQAMVLGLLLGSAVQALIPPQWVARAL
FT                   GRSDFSSVVKGGLMSLPGMMCTCCAAPVVAGLRARQAAPGAAIAFWLGNTALNPATLIF
FT                   MGFVLGWQWMGLRLALGIVMVFGLGYLVNRMVTPKEAEASREAMAQLITSDVPGTAFTR
FT                   WVKILGTMTLRLIPEYIVLVLILGAARTWLFPHVGPDIDNSLLWIVALSIAGTLFVIPT
FT                   AGEVPIIQAMLSFGMAAGPAGALLMTLPLISVPSMAMLARSFPRRVLTVVALAVVVCGV
FT                   VSGLLAVALGF"
     atgcaatcaa cccttcgaca accgcgtgtc gctctcggct ggatcgtgtt cctgctgatt        60
     gccgtcgtcg gcctcttcta tgtgaagtgg ttcccgtact acaaccgcgc cttcgtcgcc       120
     gcgagccagc actccatcgg caaatccatt ctgatgggga cgtcggcgag cgcgccggcg       180
     gcgtcgtggc aggccgcgat cgactacgcc ctcgcctacg gcaaggcgat ctggcaagcg       240
     atggtgctgg ggctgctgct cggctcggcg gtgcaggcgc tgattccgcc gcaatgggtc       300
     gcgcgtgcgc tcggccggag cgatttcagc agcgtggtga aaggcggcct gatgtcgctg       360
     ccgggcatga tgtgcacctg ctgcgcggcg ccggtcgtgg cgggcctgcg cgcgcgtcag       420
     gcggcgccgg gcgcggcgat cgcgttctgg ctcggcaata ccgccctgaa tccggccacg       480
     ttgatcttca tgggcttcgt gctcggctgg caatggatgg gcctgcggct cgccttgggc       540
     atcgtgatgg tattcggcct cgggtatctg gtgaatcgca tggtcacgcc gaaagaagcc       600
     gaagcgtcgc gcgaagcgat ggcgcaactg atcaccagcg acgtgcccgg cactgcgttc       660
     acacgctggg tgaaaatcct cggcacgatg acgctgcggc tcattcccga atacatcgtg       720
     ctggtgctga ttcttggcgc ggcgcgcacg tggctgtttc cgcatgtcgg accggatatc       780
     gacaacagtt tgctgtggat cgtcgcgctg tccatcgccg gcacgctgtt cgtgattccg       840
     accgcgggcg aagtgccgat catccaggcc atgctctcgt tcggcatggc cgccggcccg       900
     gcgggcgcct tgctgatgac gctgccgctc attagcgtac cgtcgatggc catgctcgcc       960
     cgctcgtttc cgcgccgcgt gctgacggtg gtggcgctcg ccgtggtggt ctgcggcgtg      1020
     gtcagcggat tactggctgt cgccttgggg ttttaa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page