(data stored in ACNUC7421 zone)

EMBL: CP000271.PE469

CP000271.PE469       Location/Qualifiers
FT   CDS_pept        complement(558130..559197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2556"
FT                   /product="Putative ATP /GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2556"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33437"
FT                   /db_xref="GOA:Q13R52"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R52"
FT                   /protein_id="ABE33437.1"
FT                   /translation="MKNLLVSLEKAGDFDEIIDVRTPLEFAEDHIPGALNAPVLSNEER
FT                   VLVGTTYKQVSPFEATRIGAALVARNIAHHLETTFADRPRNWRPLIYCWRGGKRSGSVT
FT                   TLFNMIGWQARQLEGGYKTYRRATLDTLDSLPATFSYIALVGPTGSGKTRLLTALNAAG
FT                   AQTLDLEALASHRGSLLGAWAGVPQPSQKRFDTLLVTALRTLDAARPVFVEAESRRIGS
FT                   VALPLALLDTFHRGRCVEVLSSREDRAAFLLHDYAHLFDDPQSLKAQLQRLIGLHSRER
FT                   VTGWQRLVDDNRRAELARELIERHYDPAYARSSHEHFVQLPHALQFNFRPNDADAVDQA
FT                   SALLAQVEGSALAVI"
     ttgaaaaacc tactcgtcag cctcgaaaaa gcaggtgatt tcgatgaaat catcgacgtg        60
     cgcacgccgc tcgagtttgc ggaagaccac attccgggcg cgctcaacgc gcctgtgctg       120
     agcaacgagg agcgcgtgct ggtcggcacc acgtacaagc aggtgtctcc gttcgaagcc       180
     acgcggatcg gcgcggcgct cgtcgcgcgt aatatcgcgc accatctgga aacgaccttc       240
     gccgaccggc cgcgcaactg gcggccgctg atctattgct ggcgcggcgg caagcgctcg       300
     ggctcggtga ccacgctgtt caatatgatc ggctggcagg cgcgtcaact ggaaggcggc       360
     tacaagactt atcggcgggc cacgctcgat acgctggaca gcttgccggc aacgttttca       420
     tacatcgcgc tggtgggtcc gaccggcagc ggcaagacgc gcctgctcac ggcgttgaac       480
     gcggcgggcg cgcagacgct ggatctcgaa gcgctggcct cgcaccgcgg ctcgctgctc       540
     ggcgcatggg ccggcgtgcc gcagccctcg cagaaacggt tcgatacgct gctcgttacc       600
     gcgctgcgca ccctcgacgc ggcacggccg gtgttcgtgg aagcggaaag ccggcgcatc       660
     ggctccgttg cgttgccgct cgcgctgctc gacacgtttc accggggccg ctgcgtggag       720
     gtgctgtcga gccgtgaaga tcgcgcggca ttcctgctgc acgactatgc gcatctgttc       780
     gacgatccgc agtcgctgaa ggcgcaattg caaaggctga tcggtttgca tagccgggaa       840
     cgtgtcacgg gctggcaacg gctcgtcgac gacaaccggc gcgccgaact cgcgcgcgaa       900
     ttgatcgagc gccactatga tccggcgtac gcgcgcagca gccatgagca tttcgtccag       960
     ttgccgcacg cattgcagtt caattttcgc cctaacgacg ccgatgccgt cgaccaggca      1020
     agcgcactgc ttgcccaggt cgagggcagc gcgctcgctg tcatctga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page