(data stored in ACNUC7421 zone)

EMBL: CP000271.PE47

CP000271.PE47        Location/Qualifiers
FT   CDS_pept        complement(52853..54253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2980"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2980"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33015"
FT                   /db_xref="GOA:Q13SC4"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC4"
FT                   /protein_id="ABE33015.1"
FT                   /translation="MSFVIVLAALAFLMFAAYRGYSVILFAPVAALGAVLLTDPAAVAP
FT                   VFTGIFMEKMVGFVKLYFPVFLLGAVFGKVIELSGFSESIVAAAIRYIGRSRANAVIVA
FT                   VCALLTYGGVSLFVVVFAVYPFAAELYRQSNIPKRLMPGAIALGAFSFTMDSLPGTPQI
FT                   QNIIPTTFFKTTSWAAPALGVIGSLFIIVVGLTYLEWRRRSAMATGEGYGTNLVNEPER
FT                   VESKQLPHPLLAVAPLVLVGVANFLLTRWIPNWYGASYTVAPDILPGIHAPVTTTIKAV
FT                   VAIWAVEGALLLGIVMVVITAFNRVRERFAIGTKAAVAGALLASLNTASEYGFGGVIAA
FT                   LPGFLVVSDALKSIPNPLVNAAVSVSSLAGITGSASGGMSIALAAMSDTFIKGAEAAHI
FT                   PMEVLHRVVAMASGGMDTLPHNGAVITLLAVTGLTHRQSYRDIFAVTVIKTMAVFFVIA
FT                   VYYATGLV"
     atgtcctttg tcatcgtcct cgccgcactg gcgtttctga tgtttgccgc ataccgcggc        60
     tacagcgtca ttctatttgc gcctgtcgcc gcgctcggcg ccgttctgct caccgatccg       120
     gccgccgtcg cgccggtttt caccggcatc ttcatggaga agatggtcgg cttcgtgaag       180
     ctctacttcc cggtgttcct gttaggcgcg gtgttcggta aggtcatcga actgtcgggc       240
     ttttcggagt cgatcgtggc cgccgcgatc cgctatatcg gccgttcgcg cgccaatgcg       300
     gtgatcgttg cggtgtgcgc gctgctcacc tacggtggcg tctcgctatt cgtagtggtg       360
     ttcgcggtct acccgttcgc cgccgagctg taccgtcaaa gcaatattcc gaagcgcctg       420
     atgcccggcg cgatcgcgct cggcgcgttc tcgttcacaa tggattcgct gcccggcacg       480
     ccgcagatcc agaacatcat cccgaccact ttcttcaaga cgacgtcatg ggccgcgccc       540
     gcgctcggcg tgatcggctc gctgttcatc atcgtggtcg gtctcacgta cctggaatgg       600
     cgccgccgct cggcaatggc gaccggcgaa ggttacggca cgaatctggt caacgagccg       660
     gagcgcgtgg aatcgaagca actgccgcat ccgttgctgg cggtggcgcc gctggttctg       720
     gtcggcgtcg cgaacttcct gctgacgcgc tggattccga actggtacgg cgcgtcgtac       780
     accgttgcgc cggacatcct gccgggcatc cacgcaccgg tcaccaccac catcaaggcc       840
     gtggtcgcaa tctgggccgt ggaaggcgcg ctgctcctcg gtatcgtcat ggtcgtcatc       900
     acggcgttca accgtgtgcg cgaacgcttc gcgatcggta ccaaggctgc ggtggccggc       960
     gcattgctgg cttcgctgaa tacggcgtcg gaatatggct ttggtggcgt gatcgcagcg      1020
     ttgccgggct ttctggtggt gagcgacgcg ctgaagagca ttcctaatcc gctcgtcaat      1080
     gcagccgttt cggtgagctc gctggccggt atcacgggtt cggcgtcggg cggcatgagc      1140
     atcgcgctcg cggccatgtc ggacacgttc atcaagggcg cggaagccgc gcatatcccg      1200
     atggaagtgc tgcaccgtgt cgtcgcaatg gcgagcggcg gcatggatac gctgccgcac      1260
     aacggcgcgg tgattacgct gctggcggtc acgggcttga cgcatcgcca gtcgtatcgc      1320
     gacattttcg cggtgaccgt gatcaagaca atggcggtct tctttgtgat cgctgtctac      1380
     tacgcgaccg gactggtctg a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page