(data stored in ACNUC7421 zone)

EMBL: CP000271.PE471

CP000271.PE471       Location/Qualifiers
FT   CDS_pept        561087..561731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2554"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   catalytic subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2554"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33439"
FT                   /db_xref="GOA:Q13R50"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R50"
FT                   /protein_id="ABE33439.1"
FT                   /translation="MPPSIIMISTPKKSRGHSMPHMSRRQFLKVSATTLAGSSLALMGF
FT                   SPTPALAEVRQYKLSRTTETRNTCPYCSVGCGILMYGLGDNAKNAKSSIIHIEGDPDHP
FT                   VNRGTLCPKGASLIDFIHSPSRLKYPEYRAAGSNEWKRISWEDALDRIAKLMKEDRDAN
FT                   FVETTEDGKKVNRWLTTGMLAASAGSNEVGYLTHKAVRSLGMLAFDNQARV"
     atgccgccct ctataatcat gatcagtacc cccaaaaaga gccgaggcca ttcaatgccc        60
     catatgtccc ggcgacaatt tctgaaggtc tccgccacca cgctagccgg atcgagtctc       120
     gccctcatgg gcttctcacc gacgcccgcg ttagcggaag tccgtcagta caagttgtcg       180
     cgcacaaccg aaacccgcaa tacctgcccg tactgttcgg taggctgcgg catcctgatg       240
     tatggacttg gcgacaacgc caagaacgcg aagtccagca tcatccacat cgaaggcgat       300
     cccgaccatc cggtcaatcg cggcacgctg tgcccgaagg gcgcgagcct gatcgacttc       360
     attcatagcc cgagccgtct gaagtatccg gagtaccgcg cggccggctc gaatgaatgg       420
     aagcgcattt cgtgggaaga cgcgctcgat cgcatcgcga aattgatgaa ggaggaccgc       480
     gacgccaact tcgtcgagac aacggaagac ggcaagaagg tcaaccgctg gctgaccacc       540
     ggcatgctcg cggcatcggc cggcagcaat gaagtcggtt atttgacgca caaggctgtc       600
     cgcagtcttg gcatgctcgc attcgacaat caggcacgtg tctga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page