(data stored in ACNUC7421 zone)

EMBL: CP000271.PE473

CP000271.PE473       Location/Qualifiers
FT   CDS_pept        564219..565151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2552"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   iron-sulfur subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2552"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33441"
FT                   /db_xref="GOA:Q13R48"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R48"
FT                   /protein_id="ABE33441.1"
FT                   /translation="MALQSLDIKRLSATTLPEPQVREPVTGTVAKLIDVSKCIGCKACQ
FT                   TACMEWNDLRDEIGTTTGIYDNPRDLSEHSWTVMRFSEYENTEGDLEWLIRKDGCMHCE
FT                   DPGCLKACPSPGAIVQYTNGIVDFHEENCIGCGYCVTGCPFNVPRISKKDNRAYKCTLC
FT                   SDRVAVGQEPACVKTCPTGAIMFGTKEDMKQQAADRVEDLKERGFQNAGLYDPAGVGGT
FT                   HVMYVLHHADKANLYHGLPQNPKISAMVGLWKGLAKPLALAGIAFAAVAGFFHYTRVGP
FT                   NEVSEAEEAEAQHEADEARRSREASNEAP"
     atggcactgc aatcactgga catcaaacgc ctctcggcca cgaccttgcc cgaaccgcaa        60
     gtgcgtgagc cggtcacggg cacggtcgcc aagctcatcg acgtgtcgaa gtgcattggc       120
     tgcaaggcgt gtcagaccgc ctgcatggaa tggaacgatc tgcgcgacga aatcggcacc       180
     acgaccggca tctacgacaa cccgcgcgat ctgagcgagc attcgtggac cgtcatgcgg       240
     ttctcggaat acgagaacac cgaaggcgat ctcgagtggc tgatccgcaa ggacggctgc       300
     atgcactgcg aggatccggg ctgtctgaag gcctgtccgt cgccgggcgc gatcgtgcag       360
     tacacgaacg gcatcgtgga tttccacgag gaaaactgca ttggctgcgg ctattgcgtg       420
     accggctgcc cgttcaacgt gccgcgcatt tcgaagaagg acaaccgcgc gtacaagtgc       480
     acgctgtgtt cggaccgtgt ggcggtcggc caggaaccgg cttgcgtgaa gacctgcccg       540
     accggcgcga tcatgttcgg caccaaggag gacatgaagc agcaggccgc cgatcgggtg       600
     gaagatctga aggaacgcgg tttccagaat gccggcttgt acgatcctgc cggcgtgggc       660
     ggcacgcacg tcatgtacgt gctgcatcac gccgacaagg ccaacctgta tcacggtttg       720
     ccgcagaatc cgaagatcag cgcgatggtc gggctgtgga aaggattggc caagccgctg       780
     gcgctcgcgg gtatcgcgtt cgcggccgta gccggcttct tccactacac gcgcgtgggt       840
     ccgaacgagg tgagcgaggc ggaagaagcc gaagcccagc acgaagccga cgaagcacgc       900
     cgttcgcggg aggcatccaa tgaagcaccc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page