(data stored in ACNUC7421 zone)

EMBL: CP000271.PE474

CP000271.PE474       Location/Qualifiers
FT   CDS_pept        565138..565794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2551"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   cytochrome b subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2551"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33442"
FT                   /db_xref="GOA:Q13R47"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R47"
FT                   /protein_id="ABE33442.1"
FT                   /translation="MKHPEHTGLKDVKGNSLIVRYTPNERTNHWITAITFVLLALSGLA
FT                   MFHPAMSWLYAIFGGGQWTRILHPFVGCVMFLSFLILALRFWHHNYLNKADIQWMKQID
FT                   DVLNNREEKLPAIGKYNAGQKLLFFTMVICLLLLLASGIVIWRRYFSFYFPIGIIRLAA
FT                   LVHAAAAFVLIVGIVVHIYAALWIKGSIGAMTRGTVTYGWARKHHPNWFKEIIGK"
     atgaagcacc ctgagcatac cgggttgaag gacgtgaagg gcaacagcct gatcgtgcgc        60
     tacacgccca atgaacgcac caatcactgg atcaccgcca tcacgttcgt gttgctggcg       120
     ctctccggcc ttgccatgtt tcatccggca atgtcgtggc tttacgcgat cttcggcggc       180
     gggcaatgga cgcggattct gcatccgttc gtgggctgcg tgatgtttct gtcgttcctg       240
     attcttgcgt tgcgcttctg gcatcacaac tatctgaaca aggccgacat tcagtggatg       300
     aagcagatcg acgacgtgct caacaatcgc gaggagaagc tccccgcgat cggcaagtac       360
     aacgccggtc aaaagctgct atttttcacg atggtgatct gcctgctgct gttgctggca       420
     agcggcatcg tgatctggcg gcgctacttc tcgttctatt ttccgatcgg gatcatccgg       480
     ctcgcggcgc tggtgcatgc ggcggcggcg ttcgtgctga tcgtcggcat cgtcgtgcat       540
     atttatgcgg cgttgtggat caagggatcg atcggcgcca tgacgcgcgg cacggtgact       600
     tacggctggg cgagaaagca tcatcccaac tggttcaagg aaatcatcgg taaatag          657
//

If you have problems or comments...

PBIL Back to PBIL home page