(data stored in ACNUC7421 zone)

EMBL: CP000271.PE475

CP000271.PE475       Location/Qualifiers
FT   CDS_pept        565904..566899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2550"
FT                   /product="Formate dehydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2550"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33443"
FT                   /db_xref="GOA:Q13R46"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R46"
FT                   /protein_id="ABE33443.1"
FT                   /translation="MVQRILEAGDIESLDHSAIPRIRTPERLAVFSARAARLRQLAALN
FT                   NPIAGYLRLMAVLADAQQAVMAGFKARPPSPELIASAQQHSMPLIPALSGVRDPAWRDV
FT                   LRQLLDKVAAAGPLTPPLEALIDHLRTLDTAALEFQSDAIFAQRFEEVDPASAPFIVAA
FT                   LQVVWTDLAADIDKREVPYIETLGLCPVCGSHPVASIVRVGGAYDNYRYLQCGLCSTEW
FT                   HMVRAKCSNCDSTKGIAYHTVGSPDADEATRETESKNAALKAESCDECHTYRKIGIQSK
FT                   DYDFEPFADDLASLTLDLLMGAEGYRRASPHPWLWPEQAAGADELSGESD"
     gtggttcaac gtattctcga agccggcgat atcgagtcgc tcgaccattc ggcgattccg        60
     cgcatccgca cgccggagcg gcttgcggtg ttctccgcgc gcgccgcgcg tctgcgccag       120
     ctcgcggcgc tcaacaatcc gatcgccggc tatttgcgcc tgatggccgt gctcgccgac       180
     gcgcagcaag ccgtcatggc gggtttcaag gcacggccgc cgagccccga gctgatcgcg       240
     agtgcccagc aacattccat gccgctgatt ccggcgcttt cgggcgtgcg cgatccggcg       300
     tggcgcgacg tgctgcgcca actgctcgac aaggtggccg ccgcgggtcc gctcacgccg       360
     ccgctcgaag cgctgatcga ccatctgcgc acgctggata ccgcggcgct cgaattccag       420
     tccgacgcga tcttcgcgca gcgcttcgaa gaggtcgacc cggcgagcgc gccgttcatc       480
     gtggccgcgc tgcaagtggt ctggaccgac ctcgccgccg atatcgacaa gcgcgaagtg       540
     ccgtacatcg aaaccctcgg cctgtgtccc gtgtgcggat cgcatccggt ggcgagcatc       600
     gtgcgcgtgg gcggcgcgta tgataactac cgttacctgc aatgcgggct gtgctcgacc       660
     gaatggcaca tggttcgggc gaagtgctcg aactgcgatt cgaccaaggg tattgcctat       720
     cacacggtcg gttcgccgga tgccgacgag gccacgcgcg aaaccgaatc gaagaacgcc       780
     gcgctgaaag cggaatcgtg tgacgaatgc catacttatc gaaagatcgg cattcagtcg       840
     aaagactacg atttcgaacc gttcgcggac gatctcgcca gtctcacgct ggatctcttg       900
     atgggcgcgg aaggttatcg gcgggcttcg ccgcatccgt ggctgtggcc cgaacaggcc       960
     gccggtgcgg acgagctctc cggcgagtcc gactag                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page