(data stored in ACNUC7421 zone)

EMBL: CP000271.PE480

CP000271.PE480       Location/Qualifiers
FT   CDS_pept        574127..575239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2544"
FT                   /product="ABC spermidine/putrescine transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2544"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33448"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R41"
FT                   /protein_id="ABE33448.1"
FT                   /translation="MKAPLSHRCNKAVNDADADAATQADSSSRSRRAFLQRAGALAGAA
FT                   ILGAPAIVRAQSKSISVTCWGGAYEAAVRAAFAEPFTKETGIAVNLVNSADLARMKVQV
FT                   ESKNVSWDVFDSIGPQIVAGSRGGMWEKLDPAIVRTDGLITRTGADFVGTYSYAGGIGF
FT                   DPKRAGKHPLTYAEFWDVTAFPGRRGLRPRVSENLEMALLADGVAPDKLYPLDIERAFK
FT                   AMDRIKPAVRKWIETTPETVSLIASNELDFTYTYLSRVLPAQRAGTSIAMSMKQTLNSL
FT                   EYLAVPKYGKNTQAAMKYVAFCLRPDRQAAFCEKVEFAPNVAQALPLVSATAKARMPDM
FT                   HDPNSVIINDTWWGDHYDALQNRFTTWMLT"
     atgaaagcgc ctctgtccca ccgctgcaac aaggcagtca acgacgccga tgccgatgcc        60
     gccacgcaag ccgattcttc gtcgcgttcg cggcgcgcct ttctgcagcg agccggagcg       120
     ctcgccggcg cggcgatcct cggcgcgccc gccatcgtgc gcgctcaatc taaaagcatc       180
     agcgtaacct gttggggcgg tgcgtatgag gcagcggtgc gtgccgcctt cgccgagccg       240
     ttcacgaaag agaccggcat cgcggtgaat ctcgtcaaca gcgccgacct cgcgcggatg       300
     aaggtgcagg tcgaatcgaa gaacgtctcg tgggacgtgt tcgacagcat tgggccgcag       360
     atcgtcgcgg gctcccgtgg cgggatgtgg gaaaagctcg atccggccat cgtcaggacc       420
     gacggactca tcaccaggac gggcgcggac tttgtcggca cctattcgta cgcgggcggt       480
     atcggcttcg acccgaagcg cgccggcaag catccgctca cctatgccga gttctgggac       540
     gtgacggcgt ttccgggacg ccgcggcctg cgcccgcggg tgagcgagaa cctcgagatg       600
     gcgttgctcg ccgacggcgt cgcgcccgac aagctctatc cgctcgacat cgagcgagcc       660
     ttcaaggcaa tggaccgtat caagccggcg gtgcgcaagt ggatcgagac gacgcccgag       720
     acggtgtcgc tcatcgcgag caacgaactc gatttcactt acacctacct gagccgcgtg       780
     ctgccggcgc agcgcgcggg gacgtcgatc gcgatgtcga tgaagcagac gctcaacagc       840
     ctcgaatatc tcgcggtgcc gaagtacggc aagaacacgc aggcggcgat gaaatacgtg       900
     gcgttctgcc tgcgcccgga ccgtcaggcg gcgttctgcg aaaaggtgga gttcgcaccg       960
     aacgtggctc aggcgttgcc gctcgtctcc gctaccgcga aggcgcgcat gccggacatg      1020
     cacgacccta acagcgtgat catcaacgac acgtggtggg gcgatcatta cgacgcgctg      1080
     cagaaccgtt ttacgacgtg gatgctgacg taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page