(data stored in ACNUC7421 zone)

EMBL: CP000271.PE481

CP000271.PE481       Location/Qualifiers
FT   CDS_pept        575254..576087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2543"
FT                   /product="ABC spermidine/putrescine transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33449"
FT                   /db_xref="GOA:Q13R40"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R40"
FT                   /protein_id="ABE33449.1"
FT                   /translation="MNYTLNLKAVVAMLLPLYGLLAVFFLWPLGVVGWSSVYEHAFTLR
FT                   GYEQALSSTLIHRVLGNTVIISVLATATSLVLGYIVALHLARMPAGKRAPYLVMVMLPF
FT                   WTSILVKSYAFTVVLGSAGIVAKLAGWLSGDAWHPDLMFSRTSVVIGMTNYLLPFMVLP
FT                   ILASLTTQNRNLKSAAELMGAGPAMIFTRITLPLSMPGVVAGVLMCLTLSMGMYITPAL
FT                   LGGPRDMMLANLIDFYTRQTLDWTLAAAIAMMLLVLSGALIGMLGRVQHGKEALV"
     atgaactata cgctgaacct caaagccgtc gtggcgatgc tgctgccgct ttacggcctg        60
     ctcgcggtgt tttttctctg gccgctcggc gtggtgggat ggtcgagcgt ctatgagcac       120
     gccttcacgc tgcgtggcta cgagcaggcg ctgagcagta cgctgattca tcgcgtgctc       180
     ggcaacaccg tgatcatcag cgtgctcgcc accgcaacca gcctcgtgct gggctatatc       240
     gtcgcgctgc atctcgcgcg catgccggca gggaaacgcg caccgtatct ggtgatggtg       300
     atgctgccgt tctggaccag cattctcgtg aaaagctacg cgttcacggt ggtgctgggc       360
     agcgcgggta tcgtcgcgaa gctcgccgga tggctgagcg gcgatgcgtg gcatccggat       420
     ctgatgttca gccgcacgag cgtcgtaatc gggatgacca attatctgct gcccttcatg       480
     gtgctgccga ttctggcgag cctcactacg cagaaccgca atctgaagtc tgccgccgaa       540
     ctgatgggcg cgggtccggc gatgatcttc acgcgcatca cgctgccgct ttccatgccg       600
     ggcgtagtgg cgggcgtgct catgtgtctc acgctctcga tgggcatgta catcacgccc       660
     gcgttgctcg gcggcccgcg cgacatgatg ctcgccaacc tcatcgactt ttacacgcgg       720
     cagacgctcg actggacgct cgccgccgcg atcgcgatga tgctgctcgt gctttccggc       780
     gcgctcatcg gaatgctcgg gcgcgtgcag cacggcaagg aggcactcgt atga             834
//

If you have problems or comments...

PBIL Back to PBIL home page