(data stored in ACNUC7421 zone)

EMBL: CP000271.PE482

CP000271.PE482       Location/Qualifiers
FT   CDS_pept        576084..576935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2542"
FT                   /product="ABC spermidine/putrescine transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2542"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33450"
FT                   /db_xref="GOA:Q13R39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R39"
FT                   /protein_id="ABE33450.1"
FT                   /translation="MMNTAAHVGKDLVQPEPKRRDRRAALRVLGSVGGWCGYLFLLLPS
FT                   LVIVPISFGGGSELTFPPRTFSFSLFQQFFADPAWWGACMTSVMVALLASAIAIAVGVP
FT                   GAYALARGHFPGKRVLETLAITPMLVPVVVLGLGIYKQFSALALVNTIGGLALAHAVLV
FT                   VPFVIIAVGSGLRHADASLEAVALVMGASRTRIFFQVVLPQIRASVAVSVLFAFLLSFD
FT                   EVVVAYFISGPQTTTLPVKMYSAIRWEVSPVLAAVSTLLTLISLLVCLGIMTLQRRDSD
FT                   TE"
     atgatgaaca ctgcggccca cgtgggcaaa gacttggtcc agcccgaacc gaagcgccgc        60
     gaccggcgcg cggcgctgcg cgtgctgggt tcggtcggcg gctggtgcgg ctatctgttc       120
     ctgctgctgc cgagcctcgt gatcgtgccc atctcgtttg gcggcggcag cgaactgacc       180
     ttcccgccgc ggaccttctc gttctcgtta ttccagcagt tttttgcgga tccggcgtgg       240
     tggggcgcgt gcatgacgag cgtgatggtg gcgctgctcg cttcggcgat cgcgatcgcc       300
     gtgggcgtgc ccggcgccta tgcattggcg cgcggacact ttccgggcaa gcgggtgctc       360
     gaaaccctgg cgatcacgcc gatgctcgtg ccggtggtcg tgctcgggct cggcatctac       420
     aagcagttct cggcgctcgc gctcgtcaac acgataggcg gactcgcgct ggcgcatgcg       480
     gtactggtcg tgccgttcgt gatcatcgcg gtgggctcgg ggctgcgtca cgcggacgcg       540
     tcgctcgaag ccgtagcgct cgtcatgggt gcgagccgca cgcgcatctt ctttcaggtg       600
     gtgctgccgc agatccgcgc ttcggtggcg gtgagcgtgc tgttcgcttt cctgctctcg       660
     ttcgacgaag tggtggtcgc gtacttcatc tcggggccac agaccacgac gctgccggtc       720
     aagatgtaca gcgcgattcg ctgggaagtg tcgccggtgc tcgctgcggt ctcgacgctc       780
     ctcacgctga tctcgctgct ggtatgcctc ggcatcatga ccttgcagcg gcgtgattcc       840
     gacaccgaat aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page