(data stored in ACNUC7421 zone)

EMBL: CP000271.PE484

CP000271.PE484       Location/Qualifiers
FT   CDS_pept        578579..579673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2540"
FT                   /product="ABC spermidine/putrescine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2540"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33452"
FT                   /db_xref="GOA:Q13R37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R37"
FT                   /protein_id="ABE33452.1"
FT                   /translation="MNMIELKQVSRRYGAVQALAPLDFSVKQGEFVTLLGPSGSGKTTL
FT                   LNVIAGMVNPSSGQIFVRGVDITKAPPSARGLGMVFQNYALMPHMTVFDNIAFPLRVRK
FT                   MPKDEIARKVKDVLDMVRLPDIAQRKPKELSGGQQQRVSLARCIVYNPALILLDEPLGA
FT                   LDKKLREQMQLEIRRLHAELGITMLNVTHDQDEALSMSDRIVLMNEGRVEQIATPDELY
FT                   RSPRTAFAASFIGTANLISGTVEHHAGERALVSTPLGMLRAAATACTASRGESVTLLVR
FT                   PESVRMGPASDSPTGDGADGLRHAGTLEDSIMLGSVVRHHVRLTGGMQMVVQQQDSRRR
FT                   PAPERGAPVLLDWAPEDCQMILQD"
     atgaacatga tcgaactgaa gcaggtctcg cggcgctacg gtgcagtgca agcgctcgca        60
     ccgctcgatt tcagcgtgaa gcagggcgag ttcgtcacgc tgctcggacc gagcgggtcg       120
     ggcaagacga cgctgctcaa cgtgatcgcg ggcatggtga atccgtcgtc cgggcagatc       180
     ttcgtgcgcg gcgtcgatat cacgaaagcg ccgccgagcg cgcgcggcct gggcatggtg       240
     ttccagaact acgcgttgat gccgcacatg acggtgttcg acaatattgc gtttccactg       300
     cgcgtgcgca agatgccgaa ggacgagatt gcccgcaagg tgaaagacgt gctcgacatg       360
     gtgcggctgc ccgacatcgc gcagcgcaaa ccgaaggagt tgtcgggtgg ccagcagcag       420
     cgcgtgtcgc tcgcgcgttg catcgtctac aacccggcgc tgatcctgct cgacgagccg       480
     ctcggcgcac tcgacaagaa actgcgggag cagatgcagt tggagatccg ccggttgcat       540
     gctgagctcg gcatcacgat gctcaacgtt acgcacgacc aggacgaagc gctgtcgatg       600
     tccgatcgca tcgtgctgat gaacgagggg cgcgtggaac agatcgcgac tcccgacgaa       660
     ctctatcgct caccgcgcac ggcgttcgcg gcaagtttca tcgggaccgc caatctgatc       720
     tcgggcacgg tggagcacca tgcgggcgaa cgggcgctcg tctcgacccc gcttggcatg       780
     ctgcgcgccg cggcgaccgc gtgcacggcg tcgcgaggcg agtccgtcac gctgctggtg       840
     cgtccggaga gcgtgcgcat ggggcccgca tccgattcgc cgaccggcga cggcgcggac       900
     ggtttgcgcc atgcgggcac gctggaagac tcgatcatgc tcggcagcgt ggtgcgtcat       960
     cacgtgcgcc ttacgggcgg catgcagatg gtggtgcagc agcaggacag ccgccggcgc      1020
     ccggcgcccg agcgcggcgc accggtgctg ctcgattggg cgccggaaga ttgccagatg      1080
     atcctgcagg actga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page