(data stored in ACNUC7421 zone)

EMBL: CP000271.PE488

CP000271.PE488       Location/Qualifiers
FT   CDS_pept        complement(583789..585372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2535"
FT                   /product="Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2535"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33456"
FT                   /db_xref="GOA:Q13R33"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R33"
FT                   /protein_id="ABE33456.1"
FT                   /translation="MRKEPRLRPKTAIPSTNDGTPAPDLEQFRLRRFLESLDDSELERH
FT                   EAPVDLADVAAIMEGNPRAVWFGRVSGSTASLAGSVAASRTRLAQAFGTTPQRLLDTVR
FT                   ERLRTKGRLVEVSREEAPVQQIVLTGDDCDFTALPVHLQHELDGAPYISASIDFAIDPD
FT                   TGWTNVGIRRLMLRGRRTAGIDLVAPSDLRAIAIGHAKRGERTPIAFAVGTHPIDHVGA
FT                   TMRIPADELELVAALRGTAMGVVKCITNDLLVPADAEFILEGYLDERGHAEPEGPYGEF
FT                   LGYYGGVKTNPVFHLTAITHRRDAVFQTCTIGGRSMACTDTAQLAALRTEVTVWRALET
FT                   AVREVNAVYANPATGGMFNVRIAMQQRVPGEARNAIAAVFASLANVKHVFVVDPDIDVF
FT                   SDEQMDWALATRFQADRDLVLQDGMRAMPLDPSLLGATKTAKAGFDLTLPLLAPGAQRD
FT                   LEHRVPTPPAYQGARFDSLEAALEDGPKRFSELMAAAGTRDGREVVRWLEDIAPRRAIA
FT                   RDAEGRYTFA"
     atgcgcaagg aacccagatt gagacccaag accgcgatcc cctcgactaa cgacggtaca        60
     cccgcacccg acctcgaaca gtttcgcctg cgccgcttcc tcgaatcgct ggacgacagc       120
     gaactcgaac gccatgaggc gcccgtcgac ctcgcggacg tcgcggcaat catggaaggc       180
     aacccgcgcg cggtgtggtt cggacgcgtg tccggcagca ccgcgtcgct cgccggcagc       240
     gttgccgcga gccgcacgcg cctcgcgcaa gccttcggca cgacgccgca gcgactgctc       300
     gacacggtgc gcgagcggct gcgcacgaaa ggccggctgg tcgaggtgag ccgcgaggaa       360
     gcgcccgtcc agcagatcgt actgaccggc gacgactgcg acttcaccgc cctgcccgtg       420
     catcttcagc acgaactgga cggcgcgccg tacatctccg cgtcgatcga cttcgcgatc       480
     gatccggaca ccggctggac caacgtcggc atccgccggc tcatgctgcg cggccgccgc       540
     accgcgggca tcgacctggt cgcgccgtcg gacctgcgcg cgatcgcgat cggccacgcg       600
     aagcgcggcg agcgcacacc gatcgcgttt gcagtcggca cgcacccgat cgaccacgtc       660
     ggcgcgacga tgcgcattcc ggccgatgag ctcgaactcg tcgcggcgct gcgcggcacg       720
     gcgatgggcg tggtgaagtg cataacgaac gacctgctgg tgcccgccga cgccgaattc       780
     attctcgaag gctatctcga cgagcgcggc cacgcggagc cggaaggccc gtacggcgaa       840
     ttcctcggct actacggcgg tgtgaagacc aacccggtgt tccacctgac ggcgatcacg       900
     catcggcgcg acgcggtgtt ccagacctgc acgatcggcg gccgctcgat ggcgtgcacc       960
     gacaccgcgc aactcgccgc actgcgcacg gaagttaccg tgtggcgcgc gctcgaaacg      1020
     gcggtgcgcg aagtgaacgc cgtctatgcc aacccggcga caggtggcat gttcaacgtg      1080
     cgcatcgcga tgcagcagcg cgtgccgggt gaagcccgca atgcgatcgc cgcggtgttc      1140
     gcgtcgctcg cgaacgtgaa gcacgtgttc gtcgtggatc cggacatcga cgtgttttcc      1200
     gacgagcaga tggattgggc gctcgccacc cgcttccagg ccgatcgcga cctggtgctg      1260
     caggacggca tgcgcgcgat gccgctcgac ccgtcactgc tcggcgcgac gaaaaccgcc      1320
     aaggcgggct tcgatctcac gctgccgctg ctcgcgccgg gcgcgcaacg cgatctcgag      1380
     catcgcgtgc cgacaccgcc cgcctatcag ggcgcgcgct tcgattcgct cgaagcggcg      1440
     ctcgaagacg gaccgaagcg gttctccgaa ctgatggccg cggccggcac gcgtgacggc      1500
     cgcgaagtgg tgcgctggct ggaagacatc gccccacggc gcgcaatcgc gcgcgacgcc      1560
     gaaggacgct acacgttcgc atga                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page