(data stored in SCRATCH zone)

EMBL: CP000271.PE49

CP000271.PE49        Location/Qualifiers
FT   CDS_pept        56098..56544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2978"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2978"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33017"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC2"
FT                   /protein_id="ABE33017.1"
FT                   /translation="MIEKQDVFGVSDETQSFLIRAPCLRHAGDRRRGCAGRLQQQRAAV
FT                   PVGRPRHDAGAMPGWFRLLLAAGRRELRRRIRRRAPVDRERHAQPDLRLPGEITGRAGR
FT                   ARPARSASQAFLRSARRATTSAGVSIAASISLVLAEWLIRASSS"
     gtgatcgaaa aacaagatgt gttcggggtt tcagatgaaa cgcagtcttt cctcattcgc        60
     gcgccgtgcc tgcgccacgc tggcgatcgg cgccgtggtt gcgctgggcg cttgcagcag       120
     cagcgcgccg ctgttcctgt cggacggccg cgccacgacg ctggtgcaat gcccggctgg       180
     ttccgactcc tgctcgcagc aggccggcgc gagttgcggc ggcgcattcg acgtcgtgcg       240
     ccagtcgacc gagaacggca cgctcaacct gatttacgcc tgccgggcga aataacgggc       300
     cgcgccggcc gcgcaaggcc ggcgcgttct gcatctcagg cattccttcg ttcagcccgc       360
     cgcgcgacta catcggcggg cgtctccatc gcagcgtcga tttcacttgt gcttgccgaa       420
     tggctcattc gcgcttcgag ttcgtga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page