(data stored in ACNUC7421 zone)

EMBL: CP000271.PE490

CP000271.PE490       Location/Qualifiers
FT   CDS_pept        complement(586231..588567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2533"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2533"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33458"
FT                   /db_xref="GOA:Q13R31"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R31"
FT                   /protein_id="ABE33458.1"
FT                   /translation="MIGQPLPRVEDRRFVTGNGKYTDDLQIEGQTYAAFLRSPHAHAGL
FT                   LSVDISAALDAPGVIAVLIGQDYLEDGYQGVDHVPNPIDAVDATKKAFLTSLTGQIFNQ
FT                   RHIPLPVDRVRYVGEPIAMVIAQTPLAARNATEMIEVEYDVLDAVVNAADAMQDGAPQM
FT                   WDGAPGNLCFQAQIGERDEARRIIAGAPLVVQREFHHSRVVNCQMEPRSAIGAYDGETG
FT                   VYTLISGSQGAVRQKLCLADALKVPPAQVRVVCPDTGGGFGPRSFIYVEQLAVVWAARR
FT                   IGRPVRWTSDRSEAFLSDYQGRDAIVRATFGFSKDGRILAIDNEWLGNVGAHTVSYVPM
FT                   SNGTRIMTTVYDVPVAAVHISAVMTNTVPTAPYRGAGRPEATHVIERMLDLAAAELGLD
FT                   RAEIRRRNLIAHEKLPYRSPMGLTYDSGEFARNMTRALELAEWNSFSERRAAARANGRL
FT                   RGIGLANYIESPVGAPRERIELTVLPEGRIDIVAGTQSTGQGHETTFAQVIAQHLGVPM
FT                   ASVTLRTGDTAFVSVGGGSHSDRSMRLGGMLLVDTAAQIVATGRQVAAALFDASPERVA
FT                   FADGGFADPASDRRIGLFEVAARIASDGVPGDPAQRKLYAHAEVNTRVPAHPTGAAVCE
FT                   LEVDPDTGVVELVNYTSVDDVGQPINPLIVEGQVHGGLAQGIGQALSETCYLDRATGQV
FT                   LTGSYMDYGMPRAGAIPPLRVELTEDPTHGNPLRVKGGGESGITPATATIFNALADALK
FT                   EFGNEELAMPATPKVVWEYIHRRAG"
     atgatcggcc aacctctccc gcgcgtggaa gaccggcgct tcgtcacggg caacgggaaa        60
     tacaccgacg acctgcagat cgaaggccag acgtatgcag ccttcctgcg ctcgccgcac       120
     gcgcatgccg gactgctttc ggtcgacatc tccgccgcgc tcgacgcgcc cggcgtgatc       180
     gccgtgctca tcggccagga ttatctggaa gacggctacc agggcgtcga tcacgtgccg       240
     aatccgatcg atgccgtgga cgcgacgaag aaggcattcc tcacctcgct gaccggccag       300
     atcttcaacc agcggcatat tccgctgccg gtggatcgcg tgcgctacgt cggcgagccg       360
     atcgcgatgg tgatcgcgca aacgccgctc gcggcgcgca atgcgacgga aatgatcgag       420
     gtcgaatacg acgtgctcga tgcggtggtc aacgcggccg acgccatgca ggacggtgcg       480
     ccgcagatgt gggacggcgc gccgggcaac ctgtgcttcc aggcgcagat cggcgagcgg       540
     gacgaagcgc gccggatcat cgccggtgcg ccgctcgtcg tgcagcgcga gttccaccac       600
     agccgcgtgg tgaactgcca gatggaaccg cgcagcgcga tcggcgcata cgacggcgaa       660
     accggcgtct acacgctgat ttccggcagc cagggcgcgg tgcggcagaa gctatgcctc       720
     gcggacgcgc tcaaggtgcc gcccgcgcag gtgcgcgtgg tctgccccga taccggcggc       780
     gggttcggcc cgcgctcgtt catttacgtc gagcagttgg ccgtcgtgtg ggccgcgcgc       840
     cgcatcggcc ggccggtcag gtggacgagc gatcgcagcg aggcgttcct gtccgattac       900
     cagggccgcg acgcgatcgt gcgcgcaacg ttcggttttt cgaaggacgg ccgcatcctc       960
     gcgatcgaca acgaatggct cggcaacgtc ggcgcgcaca cggtatcgta cgtgcccatg      1020
     tcgaacggta cgcggatcat gacgaccgtc tacgacgtgc cggtcgccgc ggtgcacatc      1080
     agcgcggtaa tgacgaacac ggtgccgacc gctccgtatc gcggcgcggg acgccccgag      1140
     gcgacccacg tcatcgagcg gatgctcgac ctcgcggcgg ccgaactcgg cctcgaccgc      1200
     gcggagatcc gccgccgcaa cctcatcgcg catgagaagc tgccgtaccg cagcccgatg      1260
     ggactcacat acgacagcgg agagtttgcg cgcaacatga cacgcgcgct ggaactcgcc      1320
     gaatggaaca gcttcagtga gcgccgcgcc gccgcgcgcg cgaacggcag gctgcgcggc      1380
     atcggactcg cgaactacat cgagtcgccg gtcggcgcgc cgcgcgagcg gatcgaactg      1440
     accgtgctgc cggaaggccg catcgacatc gtggccggca cgcagtccac cggccagggc      1500
     cacgaaacga cgttcgcgca ggtcatcgct cagcatctgg gcgtgccgat ggcgtcggtc      1560
     acgctgcgca ccggcgacac tgccttcgtc agcgtcggcg gcggcagcca ctcggaccgc      1620
     tcgatgcgcc tcggcggcat gctgctggtc gataccgccg cacagatcgt cgcgaccggc      1680
     aggcaggtcg ccgccgctct attcgacgca tcgcccgaac gcgtggcgtt cgccgacggc      1740
     ggcttcgccg atccggcttc ggatcgccgc atcggtctgt tcgaagtcgc cgcgcgcatt      1800
     gcgagcgacg gcgtgccggg cgatccggca caacgcaagc tgtatgcgca tgccgaggtc      1860
     aatacgcgcg tgcccgcaca cccgaccggc gcggccgtct gcgagctgga ggtggacccg      1920
     gacaccggcg tcgtcgagct cgtcaactac acgtcggtcg acgacgtggg ccagccgatc      1980
     aacccgctga tcgtcgaagg ccaggtacac ggcggcctcg cgcaaggcat cggccaggcg      2040
     ctctcggaga cctgctatct cgaccgcgca acgggccagg tgctgaccgg ctcgtacatg      2100
     gactacggga tgccgcgcgc cggcgcgatt ccgccgctgc gcgtcgagtt gacggaagac      2160
     ccgacccacg gcaacccgct gcgcgtgaag ggcggcggcg agagcggcat cacgccggcc      2220
     accgcgacga tcttcaacgc gctcgccgac gcgttgaagg aattcggcaa cgaggaactg      2280
     gcgatgccgg ccacgccgaa ggtggtgtgg gaatacatcc accgccgcgc cggctga         2337
//

If you have problems or comments...

PBIL Back to PBIL home page