(data stored in ACNUC7421 zone)

EMBL: CP000271.PE491

CP000271.PE491       Location/Qualifiers
FT   CDS_pept        complement(588564..589073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2532"
FT                   /product="Carbon-monoxide dehydrogenase small subunit"
FT                   /EC_number="1.2.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2532"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33459"
FT                   /db_xref="GOA:Q13R30"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R30"
FT                   /protein_id="ABE33459.1"
FT                   /translation="MAEVQLRVNGVDVERDVPDQTLLVEFLRETLRLTGTHVGCDTSQC
FT                   GACTVNLDGVSVKSCTVLAAQASGGAVTTVEGLRADQDAPLHPVQNAFVQCHGLQCGFC
FT                   TPGMIMSVDFYLRRPPKLDEESICHALEGNICRCTGYVNIIEAVRHAAHDLYPALAGAT
FT                   AEGSQS"
     atggctgaag tccaattgcg agtgaacggc gtcgacgtcg agcgtgacgt gcccgaccag        60
     acgctgctcg tcgaattcct gcgcgaaacg ttgcgcctca ccggcacgca cgttggctgc       120
     gacacgagtc aatgcggcgc ctgcacggtc aatctcgacg gcgtctccgt gaagtcgtgc       180
     accgtcctcg cggcacaggc gagcggcggc gcggtcacga ccgtcgaagg gctgcgcgcg       240
     gatcaggacg cgccgctgca tccggtccag aatgcgttcg tccagtgcca cggtctgcaa       300
     tgcggatttt gcacgccggg catgatcatg tcggtcgact tctatctgcg tcggccgccg       360
     aagctcgacg aagaaagcat ctgccatgcg ctcgaaggca acatctgccg ctgcacgggc       420
     tatgtgaaca tcatcgaagc ggtgcgccac gcggcgcacg acctgtaccc ggcactcgcc       480
     ggcgcaacgg cggagggctc gcagtcatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page