(data stored in ACNUC7421 zone)

EMBL: CP000271.PE492

CP000271.PE492       Location/Qualifiers
FT   CDS_pept        complement(589114..589599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2531"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2531"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33460"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R29"
FT                   /protein_id="ABE33460.1"
FT                   /translation="MEFTGSQTIAATREQVWKGLNDAAVLQACVPGCEEFIAQNEDEYK
FT                   AVVVASVGPVKARFKGTLALSERNGPNGYRIAGQGEGGIAGFGKMTATVTLADADQGGT
FT                   LLTYVAEAQVGGKLAQIGSRLVTSVANKLAAEFFKRFNATMSAGPDATEAANAGTAH"
     atggaattca ccggatcgca gactatcgcc gccacgcgcg aacaggtatg gaagggtttg        60
     aacgacgcgg cggtgctgca ggcatgcgtg ccgggctgcg aggagttcat cgcgcaaaac       120
     gaggacgaat acaaggccgt ggtcgtcgcc tcggtcggcc cggtgaaggc gcgcttcaag       180
     ggtacgctgg cgctgtcgga acgcaacggc ccgaacggct acaggatagc gggccagggc       240
     gaaggcggca ttgccggttt cggcaagatg accgcgaccg tcacactggc cgacgccgac       300
     cagggcggca cgctgctcac ctatgtcgcc gaagcgcagg tgggcggcaa gctcgcgcag       360
     atcggctccc ggctcgtcac gtcggtggcg aacaagctcg cggcggagtt cttcaagcgc       420
     ttcaacgcga cgatgagcgc gggtccggac gcgaccgagg ccgccaacgc gggcaccgct       480
     cactga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page