(data stored in ACNUC7421 zone)

EMBL: CP000271.PE493

CP000271.PE493       Location/Qualifiers
FT   CDS_pept        complement(589621..590439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2530"
FT                   /product="Putative carbon monoxide dehydrogenase, middle
FT                   subunit"
FT                   /EC_number="1.2.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2530"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33461"
FT                   /db_xref="GOA:Q13R28"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R28"
FT                   /protein_id="ABE33461.1"
FT                   /translation="MYETTYLRAASLDEAVAWLREHEEARPLSGGMTLIPTLKQRLAAP
FT                   SHLVDLTRIDALRGVSVEGNVLRVGALTRHAEVAASPVVASAIPALAQLAGVIADPQVR
FT                   NRGTMGGSVANNDPAADYPCAVLALGAQVITSQRRLAADDFFVDTFETALDAGELVVGF
FT                   EYPIPLRGAYAKFRQPASGYAVVGVFIAQFADAVRVAVTGAGASVFRWSEAEAALGADL
FT                   SDAALANLKMDDLALPDDDNGSAAYRAHLIETYTRRALQSLLAQPLRQPA"
     atgtacgaga ccacctattt acgggccgca tcgctcgacg aggccgttgc ctggctgcgc        60
     gagcacgagg aagcgcgacc gctgtccggc ggcatgacgc tgatccccac gctcaagcag       120
     cggctcgccg cgccttcgca tctggtcgac ctgactcgca tcgacgcgct gcgcggtgtg       180
     agcgtggagg gcaacgtgct gcgcgtcggc gcgctgacga ggcatgcgga agtggccgct       240
     tcgcccgtgg tggcgtcggc gatcccggcg ctcgcgcaac tcgcaggcgt gatcgccgat       300
     ccgcaggtcc gcaatcgcgg cacgatgggc ggctcggtcg cgaacaacga tccggcggct       360
     gactatccgt gcgcggtgct cgcactcggc gcgcaggtga tcacgtcgca gcgccggctc       420
     gcggccgacg atttcttcgt cgatacgttc gaaaccgctc tcgacgccgg cgaactggtc       480
     gttggattcg aataccccat tccgttgcgc ggcgcgtatg cgaagttccg ccagccggcg       540
     tccggttatg cggtggtggg cgtgttcatc gcgcagttcg ccgatgcggt gcgggtcgcg       600
     gtaacgggtg cgggcgcctc ggtgttccgc tggtccgaag ccgaagcggc gctcggcgcc       660
     gacctttccg acgccgcact cgcgaacctg aagatggacg acctggcgct cccggacgac       720
     gacaacggtt cggccgcgta tcgcgcccat ctgatcgaaa cctacacgcg ccgcgcattg       780
     caatcgctgc tcgcgcaacc gctgcgccag cccgcttaa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page