(data stored in ACNUC7421 zone)

EMBL: CP000271.PE501

CP000271.PE501       Location/Qualifiers
FT   CDS_pept        598390..599823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2522"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2522"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33469"
FT                   /db_xref="GOA:Q13R20"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R20"
FT                   /protein_id="ABE33469.1"
FT                   /translation="MTQPRTLYDRIFDAHVVRTDADGTTLLYIDRHLLNEVTSPQAFES
FT                   LRREGRPVWRPQANLAVADHNVPTTDRRLGIADPVSRIQVDVLRENCERSGIVHYGMDD
FT                   ARQGIVHVVGPELGCTLPGMTIVCGDSHTSTHGALGALAFGIGTSEIEHVLGTQTLITR
FT                   RSRTMRMTLDGVLPPGCTAKDVALAVIGALGTAGGTGYAIEFAGPVVRALSMEGRMTLC
FT                   NMSIEAGARAGLIAVDETTLDYCRTRPHAPQGETWELSARVWRALRSDDDARFDAECSL
FT                   DVSTLAPQVTWGTSPEMVTGIDGRVPDPLDIHDAGRRASWQRALDYMGLDAGTRIDTIA
FT                   IDKVFIGSCTNGRLEDLRAAADILRATGGRIASNVRLALAVPGSQQVKRDAEAEGLHDV
FT                   FIAAGFEWREPGCSMCLAMNPDRLEPGERVASTSNRNFEGRQGAGGRSHLVSPAMAAAA
FT                   ALAGRFADVRPFASGMGGL"
     atgacccagc cccgtaccct gtacgacagg attttcgacg cgcacgtcgt tcgcaccgat        60
     gcggacggca cgacattgct ttacatcgac cggcatctgc tgaacgaggt gacgagcccg       120
     caggcgttcg aatcgttgcg gcgcgaggga cggccggtct ggcgcccgca ggccaatctc       180
     gcggtcgcgg accataacgt gccgacgacc gaccggcgcc tcgggatcgc cgatccggtg       240
     tcccggatcc aggtggacgt attgcgcgag aactgcgagc gcagcgggat tgttcactat       300
     gggatggacg acgcgcgcca gggcatcgtg catgtcgtcg gcccggaact tggctgcacg       360
     ctgccgggta tgacgatagt ctgcggcgat tcgcatacga gcacacatgg cgcgctgggt       420
     gcgctcgcat tcggtatcgg tacgtcggag atcgaacacg tgctcggcac gcagacgctg       480
     attacgcggc gcagccggac gatgcgcatg acgctggacg gtgtgctgcc gcccggctgc       540
     acggcgaagg acgtcgcgct tgccgtgatc ggtgcgctcg gcacggccgg cggcacgggt       600
     tacgcaatcg agttcgcggg cccggtggta cgtgcgctgt cgatggaagg gcgcatgacg       660
     ctgtgcaata tgtctatcga agcgggcgcg cgtgccggcc tgatcgcggt cgacgagacc       720
     acgctcgatt actgccgcac gcggccgcat gcgccgcaag gcgagacgtg ggaactttcg       780
     gcacgcgtat ggcgcgcgct gcgctcggac gacgacgcgc gctttgacgc cgaatgctcg       840
     ctcgacgtct cgacgttggc gccgcaggtg acctggggca cgtcgccgga gatggtgacc       900
     ggcatcgacg gccgggtgcc cgatccgctg gacatccacg acgccgggcg gcgcgcgtcg       960
     tggcagcgcg cgctcgacta catggggctc gacgcgggca cgcgcatcga tacgattgcg      1020
     atcgacaagg tgttcatcgg ctcgtgcacg aacggccggc tcgaagatct gcgcgcggcc      1080
     gccgacattc tgcgtgcaac gggcggacgg atcgcgtcga atgtacgcct cgcgctcgcg      1140
     gtgccgggtt cgcagcaggt caagcgcgac gcggaagcgg agggtctgca cgacgtattc      1200
     atcgccgccg gcttcgaatg gcgcgagccg ggctgctcga tgtgtctcgc gatgaatccc      1260
     gaccggctcg aaccgggtga acgcgtggcg tcgacgtcga accgcaattt cgagggccgg      1320
     caaggcgccg gcggccgttc gcatctggtc agcccggcaa tggccgcggc cgccgcgctc      1380
     gcgggccggt tcgccgatgt ccggccgttc gcttctggta tgggaggcct ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page