(data stored in ACNUC7421 zone)

EMBL: CP000271.PE502

CP000271.PE502       Location/Qualifiers
FT   CDS_pept        599823..600455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2521"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2521"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33470"
FT                   /db_xref="GOA:Q13R19"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R19"
FT                   /protein_id="ABE33470.1"
FT                   /translation="MEPLVCHEGLVVPLDRDNVDTDAIIPKQFMKSIARTGFGPYLFDE
FT                   WRYRDPGHYGKPAAERTPEPGFALNQQRYAGASVLLTRRNFGCGSSREHAPWALHQFGF
FT                   RVLVAESFADIFFNNCCKNGLLPVRLDAALIGRLMETVEAAHGYRLRVDLAAQTLTAPD
FT                   GECWRFDIPPALRTLLLEGLDETGATLAFADAIRAFEAVQLERSPWL"
     atggaaccgc tcgtgtgtca tgaaggtctt gtcgttccgc tcgatcggga caacgtcgat        60
     acggacgcga tcatcccgaa gcagttcatg aagtccatcg cgcgaaccgg tttcggtccc       120
     tatctgttcg acgaatggcg ctaccgcgac cccggccatt acggcaagcc ggcggccgaa       180
     cgcacgcccg agccgggctt cgcgctgaac cagcagcgct acgcgggcgc ctcagtgctg       240
     ctcacgcggc gcaatttcgg ctgcggcagt tcgcgcgagc acgcgccgtg ggcgctgcat       300
     caattcggct tccgggtgct cgtggccgag agcttcgccg acatcttctt caacaactgc       360
     tgcaagaacg ggctgctgcc ggtacggctc gatgccgcac tgatcggccg gctgatggaa       420
     acggtggagg ctgcgcacgg ctaccgtctg cgcgtggatc tggctgcgca gacactcact       480
     gcgccggacg gcgagtgctg gcgcttcgac atcccgcccg cgctgaggac gctgctgctc       540
     gaaggcctcg acgaaaccgg cgcgacgctt gcattcgccg acgcgatccg tgcgttcgag       600
     gccgttcaac tcgaacgttc gccgtggctc tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page