(data stored in ACNUC7421 zone)

EMBL: CP000271.PE507

CP000271.PE507       Location/Qualifiers
FT   CDS_pept        606637..607044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2516"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2516"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33475"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R14"
FT                   /protein_id="ABE33475.1"
FT                   /translation="MTIDEAQQLVSRGPYLNWLGLEVLDLGADTITVKAKWRPEWVANP
FT                   TLGQTHGGILAALIDFAADFSLLNSLGHPVPTIDMRVDYHRLTKQCDLIAKGRVIKLGR
FT                   QFSICEAQIFDGSNLLIASGRGAYITAPKES"
     atgactatcg acgaggcgca gcaactcgtg tctcgtggcc cgtacctgaa ctggctgggg        60
     ctagaggttc tcgacctggg agcggacacg atcaccgtga aagcgaaatg gcggccggaa       120
     tgggtggcca acccgaccct cgggcagacg cacggcggca ttctggccgc gttgatcgac       180
     ttcgccgctg atttctcgct gctcaacagc ctagggcacc cggttccgac gatcgatatg       240
     cgagtcgact accaccgctt gaccaaacag tgcgatctga ttgcaaaagg gcgcgtgatc       300
     aaactcggca ggcagttttc gatctgcgag gcgcagattt ttgacgggag taatctgctg       360
     atcgcgagcg gacggggcgc gtatattacc gcgccgaaag aaagttag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page