(data stored in ACNUC7421 zone)

EMBL: CP000271.PE508

CP000271.PE508       Location/Qualifiers
FT   CDS_pept        607122..607604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2515"
FT                   /product="putative tripartite tricarboxylate
FT                   transporter(TTT) family, TctB (4TM) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2515"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33476"
FT                   /db_xref="GOA:Q13R13"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R13"
FT                   /protein_id="ABE33476.1"
FT                   /translation="MSNGRERRFVTEYTRDYYGGALMLLVGLAAAFQGSRYGIGSMTHM
FT                   KAGFYPVVLGVILAILGVIIAGSATRVPSGDTEDEAQPSEWRGWICIVSSILAFLLLGK
FT                   FGGLLPASFAIVFISALGDRDNSVRAALIVATAISAVSVVLFWWALQLQFPLFSWG"
     atgtcaaacg gcagggaacg gcggttcgtg acggaataca cgcgcgacta ttacggtggc        60
     gcgttgatgc tgctggtagg actcgctgcc gcctttcagg gttcgcgata cggcatcggc       120
     tcgatgacgc acatgaaggc cggcttttat ccagttgtat taggtgtgat tctcgcaatc       180
     ctcggcgtga tcattgcagg cagcgcgacc agggttccct ctggagatac ggaagacgaa       240
     gcgcaaccat cggaatggcg tggctggatc tgtattgttt caagcattct tgcttttctc       300
     ctgcttggaa aattcggcgg cctgttgccg gccagtttcg ccatcgtgtt catctcggca       360
     ctgggcgacc gggacaacag cgttcgtgcg gcgctcatcg tcgcgaccgc tatttccgcc       420
     gtcagcgtcg ttctcttctg gtgggcgttg caacttcaat ttccgctatt cagctggggc       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page