(data stored in ACNUC7421 zone)

EMBL: CP000271.PE513

CP000271.PE513       Location/Qualifiers
FT   CDS_pept        613299..613658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2510"
FT                   /product="predicted sulfurylase small subunit,
FT                   molybdopterin cytosine dinucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2510"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33481"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R08"
FT                   /protein_id="ABE33481.1"
FT                   /translation="MNRVDLDVLKSSYRWLADGCRVLLVTVVGTWGSSPRPGGAMPAVR
FT                   ADGRVAGSVSGGCIEDDLIEQVRRNGIEQTRPQLAGYGVSVEKTRYVAASLVKVSGSGW
FT                   STGNVSGARAAPADA"
     atgaaccgcg tggacctcga cgttctgaag tccagttatc gttggctggc cgacggatgt        60
     cgagtgctgc tcgtgacagt tgtcggaaca tggggttcgt cgccgcggcc tggaggcgcg       120
     atgcctgctg ttcgtgccga cggtcgcgtg gcgggctcgg tatcgggcgg ctgtatcgag       180
     gatgacctga tcgagcaggt acgtcgcaac ggtatcgagc agacaaggcc tcagttggcc       240
     ggatacggcg tcagcgtgga gaagacgcgg tatgtagcgg cgtcgctcgt caaggtgtcc       300
     ggcagcggtt ggagcacagg caacgtgagt ggggcgagag cagcgccggc cgatgcatga       360
//

If you have problems or comments...

PBIL Back to PBIL home page