(data stored in ACNUC7421 zone)

EMBL: CP000271.PE516

CP000271.PE516       Location/Qualifiers
FT   CDS_pept        616598..616861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2507"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33484"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R05"
FT                   /protein_id="ABE33484.1"
FT                   /translation="MNEIRKHPLMNSVGNALGARRLPTAWLIRGAQRSAQRRARALMNE
FT                   SCYSLMFDWFAGLTAWGAVWESVVCPDESAQLMQHEVSEAFL"
     atgaatgaaa tacggaaaca cccgttgatg aactcagtgg gcaacgcttt gggtgcgcgg        60
     cgattgccga cagcctggtt gatacggggc gcacaacgaa gcgcacaacg acgcgcacgc       120
     gcactaatga acgagagctg ttacagcctg atgttcgact ggtttgcggg gcttacggca       180
     tggggcgccg tgtgggagag cgtcgtgtgt cctgatgaga gcgcgcaact gatgcaacac       240
     gaagtctccg aggctttcct atga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page