(data stored in ACNUC7421 zone)

EMBL: CP000271.PE517

CP000271.PE517       Location/Qualifiers
FT   CDS_pept        616858..617388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2506"
FT                   /product="Putative oxidoreductase, alpha subunit"
FT                   /EC_number="1.3.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33485"
FT                   /db_xref="GOA:Q13R04"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R04"
FT                   /protein_id="ABE33485.1"
FT                   /translation="MTTGITITVNGRQHAVQADPETPLVYVLRNELGLYATKFGCGVAQ
FT                   CGVCSVLLDGQEIRSCIMPVSMAAGHEITTLEGLGELWEQRKRTPGTSLHREPETTDLH
FT                   PIQEAWIKLQVPQCGYCQSGMMIQAVSLLNTNPQPTRSDIVASMQGHICRCGTHMRIIS
FT                   AIEQAADHMSKEG"
     atgacaaccg gaattaccat taccgtgaac ggccggcagc atgccgttca ggccgacccc        60
     gaaaccccgc ttgtctacgt attacgcaat gagcttggac tgtatgcgac gaagttcggc       120
     tgtggtgttg cgcagtgtgg cgtgtgctcg gtgctgctcg acgggcagga gattcgctcc       180
     tgcatcatgc ccgtgtcgat ggctgcggga cacgaaatca cgacgctgga ggggttaggc       240
     gaactgtggg agcaacgaaa gcgcacgccc ggcacgtctt tacatcgtga acccgaaacg       300
     acggatctgc atcccataca ggaagcgtgg atcaagctgc aggtaccgca atgcggctat       360
     tgtcaaagcg ggatgatgat ccaggcggtc agtctcctga acacgaatcc gcagcccacg       420
     agaagtgaca ttgtcgcttc catgcaaggg cacatctgcc gttgcggcac gcacatgcgg       480
     atcatctcgg cgatcgaaca ggccgccgac cacatgagca aggaaggctg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page