(data stored in ACNUC7421 zone)

EMBL: CP000271.PE518

CP000271.PE518       Location/Qualifiers
FT   CDS_pept        617392..619662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2505"
FT                   /product="Putative oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33486"
FT                   /db_xref="GOA:Q13R03"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R03"
FT                   /protein_id="ABE33486.1"
FT                   /translation="MPRENLPSSPAGNVVSPGRRGFLKAGGALVVTFCIPVISSSATRA
FT                   DTFGKVPPEQLDSWIAVQQDGSVSAFTGRIDMGTGVETVFVQAVAEELDVPVSSVTFVM
FT                   GDTARTVDQGKSTASNNIARNLPPLRQAAAEARLALMDLAAARLGVPSQKLVVKDGVVS
FT                   VSGGGQSVSYGELVGGKRFDIRLGVKGDGNRTQLTGRAKLKDPKEFKVLGTSVPRVDIP
FT                   AKVQGKFKYVHDVVVDGMAHGTVVLPPARGMKLVSVNGFAQPVPGVVKVVTRGNFVGIV
FT                   AETEQAAVRARNALNVTWAPGTNENFDDMYGTIRKTPVIKDEIEGVVGNVRTAFANAAT
FT                   VVEGTYYLPVNSHGMMGPSCAVADFREGSLTLWSGSQWPDGTRRDVAGMLGMPIDKVRL
FT                   IWVQGSGSYGRLGVDDAAGDAALLSQAVGRPVRVQWQRADENQWSPFCPAAVIHVKAGL
FT                   DAQGKITAWEFENWTPGHSTAEQGNILAWRALGTNPGHKRLSGGADSPSYDIANINVVT
FT                   HYTHEIVRAIYMRSVAGIQNAFAIESMMDDLAAKAGMDPIAFRLKHTTNKRSRIVLETV
FT                   ARKAGWKPLQKPVIDGDLIESRGIGALCAGDGKLANHGAWGNLATIVDIVLNKRTGVIR
FT                   VKRVFVAFDAGRVANPDGLRNQAEGGTIMGISRALKEQVLFRGAAVASADWLTYPVLQF
FT                   SDVPESIDVTLIDSDHAPLGAGEVPNVTPACAIGNAVFAATGVRIRELPLTPDRVKAAL
FT                   TVA"
     atgccacgcg agaatcttcc atcgtccccg gcggggaatg tcgtgtcgcc cggtcggcgc        60
     ggttttctga aagccggcgg cgcactggtc gtcactttct gtattccggt gatcagctcg       120
     agcgccacgc gcgcggacac cttcgggaaa gtgcctcctg aacagctgga ctcgtggatc       180
     gcggtccagc aggatggttc ggtgtccgcg tttaccggcc gcatcgatat gggaacaggt       240
     gttgagaccg tgttcgtcca ggcggtggcc gaagaactgg acgtgccggt cagttcggtc       300
     acgttcgtta tgggcgacac cgccagaacg gtcgatcagg gtaagtcgac ggccagcaac       360
     aacattgcga gaaatcttcc gccgctgcgc caggcagcgg cggaggccag gctggccctc       420
     atggatctgg ctgcggcccg gctgggtgtg ccgtcgcaaa agcttgtcgt caaggacggc       480
     gtggtcagcg tgtccggcgg cggtcaatcg gtcagctatg gggaactggt tggcggcaag       540
     cgtttcgaca tcaggctggg cgtcaagggg gacggcaacc ggacccaact gaccgggcgt       600
     gcgaaactca aggatccgaa ggaattcaaa gtactcggta cttccgtgcc acgcgtcgac       660
     attccggcaa aagtgcaggg caagttcaaa tacgtgcatg acgtcgtggt tgacggcatg       720
     gcgcacggta cggtggtgct gccgcccgcg cgcgggatga agctggtgtc cgtgaatggt       780
     tttgcgcagc cggttcccgg cgtggtcaag gtcgtgacgc gcggcaattt cgtcggtatc       840
     gttgcggaga ccgaacaggc ggccgtgcgt gcgcgaaatg cgctgaacgt gacgtgggcg       900
     cccggcacga acgaaaattt cgacgacatg tacggcacga tccgcaagac gccggtcatc       960
     aaggacgaga tcgaaggcgt ggtcggcaat gtcaggaccg ctttcgcgaa cgcggcgacg      1020
     gtggtcgagg gaacctatta tcttccggtg aattcgcacg gcatgatggg accgtcttgc      1080
     gccgtggcgg atttccgcga gggcagcctg acgctctggt ccggatcgca gtggccggac      1140
     ggtacgcggc gcgacgtggc gggcatgctc ggtatgccca tcgacaaggt caggctgatc      1200
     tgggttcagg gctcgggttc gtacgggcgc ctcggcgtgg acgatgctgc gggcgatgcc      1260
     gcgctgctct cgcaggccgt tggaaggcct gtacgggtgc agtggcagcg cgcggacgaa      1320
     aaccagtggt cgccgttctg tccggccgcc gtcattcacg tgaaggccgg gctcgacgca      1380
     caggggaaga tcaccgcgtg ggagttcgag aactggacac cgggccactc gacggccgaa      1440
     cagggcaata tactggcctg gcgcgcgctg ggcaccaacc ctggccacaa acgcctgagc      1500
     ggcggcgccg acagtccgag ttacgacatc gccaacatca acgtcgttac gcattacacc      1560
     catgagatcg tccgcgcgat ttacatgaga tcggtcgcgg gtattcagaa tgccttcgcg      1620
     atcgaaagca tgatggacga tctggccgcg aaagcgggca tggatcccat tgcattccgc      1680
     ctgaaacaca ccacgaacaa gcgctcgaga atcgtgctcg aaaccgtggc gcgcaaagcg      1740
     ggctggaagc cgttgcagaa gcccgtgatc gacggcgatc tgatcgaaag ccggggcatt      1800
     ggcgccttgt gcgccggaga cgggaaactg gcgaaccacg gggcctgggg taatctcgcc      1860
     acgatcgtcg acatcgtgct caacaagcgg accggcgtga ttcgcgtgaa gcgggttttc      1920
     gtcgccttcg acgcaggaag agtcgccaat cccgacggac tgcgcaatca ggccgagggt      1980
     ggaacgatca tgggtatcag ccgcgcgttg aaggagcagg tattgttccg cggcgccgcg      2040
     gtcgcttccg cggactggct gacgtatccg gttctgcagt tcagcgacgt gcccgaatcg      2100
     atcgacgtca ccttgatcga ctccgatcat gcgccgctcg gggcaggcga ggtgccgaac      2160
     gtgacgccgg catgcgctat cggcaatgcc gttttcgcgg cgaccggcgt gcggattcgc      2220
     gagcttccgc tcacgcccga tcgcgtcaag gcggcactca ccgttgcctg a               2271
//

If you have problems or comments...

PBIL Back to PBIL home page