(data stored in ACNUC7421 zone)

EMBL: CP000271.PE528

CP000271.PE528       Location/Qualifiers
FT   CDS_pept        631581..631931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2495"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2495"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33496"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ3"
FT                   /protein_id="ABE33496.1"
FT                   /translation="MNDIVRIDQNARRSRALIHNGLLYISGQVPDERKGGVADQTRQVL
FT                   AKIDDLLKEAGTSKDRLLSAQIWLKTMDDFAEMNAVWDAWVIPGKTPTRCCGKVELNDP
FT                   HCLVEIVAVAAC"
     atgaacgaca tcgttcgcat cgaccagaac gcccggcgca gccgcgcgct tattcacaac        60
     ggactcctgt acatttccgg acaggtacct gacgagcgca agggaggtgt cgcggatcag       120
     acccggcagg tgcttgcaaa aatcgacgat ctgctcaagg aggcgggtac gtcgaaagac       180
     agactgctga gtgcccagat ctggttgaag acgatggatg acttcgccga aatgaacgcg       240
     gtgtgggacg cgtgggtgat acccggcaag acgcctaccc gttgctgcgg caaggtggaa       300
     ttgaatgatc cgcattgcct cgtggagatc gttgcagtgg cagcctgcta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page