(data stored in SCRATCH zone)

EMBL: CP000271.PE53

CP000271.PE53        Location/Qualifiers
FT   CDS_pept        59158..59565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2974"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2974"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33021"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB8"
FT                   /protein_id="ABE33021.1"
FT                   /translation="MSLVLPKRAPCGQLAAGRPPSLADFSETRASLCWRAFPGCAKNRC
FT                   GEGSRLFQPRLRCSALRGLSLCRCATDRPQAHLSAPFKVASASVPKTLTFASPTPAGHW
FT                   AFAIFYADHVRVFQSRQRVFAGSVLSPRCVL"
     gtgagcctgg ttttgccgaa gcgcgcacct tgcggccagc ttgccgctgg ccgcccgccg        60
     tcactggccg atttctctga aacccgcgcc agcctttgct ggcgggcgtt cccaggctgt       120
     gcgaagaatc gctgcggcga aggctcgagg ctcttccagc cacgtctgcg gtgttcggca       180
     ctgcgcggac tttcgctgtg caggtgcgcg accgatcgtc cacaagctca cctttcggcg       240
     ccattcaaag tcgcatcggc gagcgtcccg aaaaccctca cctttgcgag cccgacaccc       300
     gcaggccact gggcgtttgc gatcttttac gctgaccatg tccgcgtttt ccagtcgcgt       360
     cagcgcgtgt tcgccgggag tgttttatca ccgaggtgtg tcctgtga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page