(data stored in ACNUC7421 zone)

EMBL: CP000271.PE530

CP000271.PE530       Location/Qualifiers
FT   CDS_pept        633747..634112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2493"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33498"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ1"
FT                   /protein_id="ABE33498.1"
FT                   /translation="MMSWGCVIGCAADFSRLFQCPKHMKLVIIRHRLLPGAAETALARI
FT                   NVLSERMRTQPGYCFRHVGTEAGDESCITSVTAWATASDCAAWEAHLAASPLPKVERLY
FT                   SSVEHISVDADGTSPHG"
     gtgatgtcct ggggctgcgt cattggctgc gcagcggatt tcagtcggtt atttcaatgc        60
     ccgaaacata tgaaacttgt catcattcgt catcgtttgc ttcctggtgc ggccgaaacg       120
     gcgctcgccc gtattaacgt attgtccgag cgcatgcgaa cgcagcccgg ttactgtttt       180
     cgtcatgtag gcacggaagc gggcgacgaa tcgtgcatca ccagcgtgac ggcctgggcg       240
     acggcgtcgg attgcgccgc atgggaggct catctagcgg catcgccgct gccgaaggta       300
     gagcgtcttt acagctcggt cgagcatatc agcgtggatg cggacgggac ttcaccgcac       360
     ggatag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page