(data stored in ACNUC7421 zone)

EMBL: CP000271.PE532

CP000271.PE532       Location/Qualifiers
FT   CDS_pept        635621..635926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2491"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33500"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY9"
FT                   /protein_id="ABE33500.1"
FT                   /translation="MTPLTFDQFKTQLESMLRDIPYGTSADLTGFAIAFWDGGKVVYAF
FT                   LSADGCGVIEDEFELTDYEWQHWQDDLAAWINEPMFSVRPEINKRAWTAPAGSGGR"
     atgacgcctc ttaccttcga ccagttcaag acccaactgg agtcgatgct gcgagatatt        60
     ccctatggca ccagcgccga tctgacgggc ttcgcgatcg cgttctggga cggcggcaag       120
     gtcgtctatg ccttcctctc cgcagacggc tgcggcgtga tcgaggatga attcgagctg       180
     accgactatg agtggcagca ctggcaggac gatctcgccg cctggatcaa cgagccgatg       240
     ttcagcgttc ggcccgaaat caacaaaagg gcctggacag cacccgccgg cagcggcgga       300
     cggtag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page