(data stored in ACNUC7421 zone)

EMBL: CP000271.PE533

CP000271.PE533       Location/Qualifiers
FT   CDS_pept        complement(635948..637612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2490"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2490"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33501"
FT                   /db_xref="GOA:Q13QY8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY8"
FT                   /protein_id="ABE33501.1"
FT                   /translation="MRHRILATPVSSNLSLVAVRDRSRQIGELFGLDNLQRTRFITAVS
FT                   EIARNAVQFAGGGMLTFFVGDATDAGDTQCVVAQISDKGPGIARLDAVLADASHRPGAA
FT                   GVGILGSQRMADGFFVESQPGQGTIVTIEMFLPRGTARLSVRALGELVEQITHRKPQSP
FT                   VEELEKQNREMLLALEELRRKRAELEEADIRKNEFLAMLAHELRNPLAAISLSLELAAQ
FT                   ADRSRSGQAFAVIGRQTAQLSRMVEDLLDVSRLTRGKVELQTEVVRVDTLIEGGIEIAA
FT                   AEIRRRGHTVRVTCPPEQLSVRVDVARLKQVFNNIIHNAARYTPQPDTIDITVTNSHSE
FT                   VVVAITDRGIGIDPVILPHIFDLFTQAAGGIGRQEAGLGIGLTVVQRLVQDHGGSVEAF
FT                   SDGIGKGSKIVVTLPVAHEEMARDDAEIFVETAQTGVIHKVLVVDDNRDSADALAALLD
FT                   MHGHECRVAYDGASALELAEQFAATVGIVDLGLPDMPGFEVARALLERPRPAPLTLIAL
FT                   TGYSSAGFRASATQAGFHHFFVKPVSVDELLRYLENR"
     atgcgacatc gaattctggc gacgcccgtc agttccaatt tgagtctcgt cgcggtgagg        60
     gaccgttcgc gtcagatcgg cgaactgttc ggactcgaca atctgcagcg tacgcgtttc       120
     atcaccgcag tgtccgagat cgcgcgcaac gcggttcagt tcgcgggcgg cggcatgctg       180
     acatttttcg tcggcgacgc cacggacgcc ggcgacactc aatgcgtggt cgcgcagatc       240
     agcgacaaag ggccgggcat cgcccgtctg gacgcggtgc tggccgacgc cagccatcgc       300
     cctggcgcgg cgggcgtggg cattctcggc agtcagcgca tggccgacgg attcttcgtc       360
     gaatcgcagc ccgggcaagg cacgattgtc acgatcgaga tgttcctgcc gcgcggcacg       420
     gcgcgccttt cggtgcgcgc gcttggagaa ctcgtcgagc agatcactca ccgcaagcct       480
     cagagcccgg tcgaagaact cgaaaagcag aaccgggaaa tgctgctcgc gctggaagag       540
     cttcgccgca agcgcgcgga gctcgaagaa gcggatattc gaaagaacga atttctggcg       600
     atgctggcgc acgaactgcg caatccgctg gcggcgattt cgctgtcgct ggaactggcg       660
     gcgcaagcgg acaggagccg gtccgggcaa gcgttcgcgg tgattggaag gcaaaccgcg       720
     caactgtccc gcatggtcga ggatctgctc gacgtctcac ggctcacacg cggcaaggtc       780
     gaactgcaga ctgaagtcgt gcgggtcgat acgcttatcg agggcggcat cgaaatagcg       840
     gcggcagaaa tcaggcggcg cgggcacacg gttcgggtca cctgtccgcc ggagcagctg       900
     tcggttcgcg tcgacgtcgc gcggctgaaa caggtattca acaacatcat ccacaatgcc       960
     gcgcggtaca cccctcaacc ggacaccatc gatatcacgg tgacgaactc gcacagcgag      1020
     gtcgtggttg cgattaccga tcgcggcatc ggcatcgatc ccgtcatcct gccgcacata      1080
     ttcgacctgt tcacccaggc ggcgggcggt ataggcaggc aggaagccgg actggggatt      1140
     ggattgacgg tcgtgcagcg gctcgtgcag gatcacggcg ggtcggtcga agcgtttagc      1200
     gacggaatcg gcaagggctc gaaaattgtc gtgacgctgc cggtcgcgca tgaggaaatg      1260
     gctcgcgacg acgccgagat cttcgtcgag acggcgcaaa cgggcgtgat acacaaggta      1320
     ttggtcgtcg acgacaaccg ggactccgcg gatgccctcg ctgcgttgct cgacatgcac      1380
     gggcacgagt gcagggtcgc ttacgacggt gcttcggctc tcgaactcgc ggagcagttc      1440
     gccgcgacgg tcggcatcgt cgacctggga ttgcccgata tgcccggttt cgaggtggcc      1500
     agggcgctgc tcgagcgccc gcgcccggcc ccgttgacgc tgattgcgtt gaccggctat      1560
     tcgagcgcag ggtttcgggc gagtgcgacg caagcgggtt tccatcactt cttcgtcaag      1620
     ccggtctccg tcgacgagtt gctgaggtat ctggagaaca ggtag                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page