(data stored in ACNUC7421 zone)

EMBL: CP000271.PE534

CP000271.PE534       Location/Qualifiers
FT   CDS_pept        complement(637614..638606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2489"
FT                   /product="Anti-Sigma regulatory factor (Ser/Thr protein
FT                   kinase and phosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2489"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33502"
FT                   /db_xref="GOA:Q13QY7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY7"
FT                   /protein_id="ABE33502.1"
FT                   /translation="METTLSLADKSGVAHARRRAVEMAQALGLPDRSQADAALVVTEAA
FT                   TNILKYAGHGEIVLKSTDDAGASSLDVIALDRGPGIANLGAACSDGFSTGGSLGAGLGT
FT                   IARHSAVFDIYSIQGCGTALFARVGEKAAAEHPRFLVGAKSTPKRGQDINGDAWSVRHA
FT                   GGNLWLTLLDGLGHGPLAAEASRRAVDVFMRADPAALPQEVLRDVHSGIKATRGAVMAI
FT                   ARFDPVNAILSFAGVGNIVGIVNAGETTQHLLSTDGTVGYNMRSVRPTEARWAPGSVFI
FT                   ATTDGLTTRWNLNRHPGLISRHPSLIASVLHRDFARDSDDATIVVVKAL"
     atggaaacga cgctaagcct cgccgacaag agcggcgtgg cgcatgcgcg caggcgcgct        60
     gtcgaaatgg cgcaggcact gggccttcct gacagatctc aggcggatgc ggccctggtg       120
     gtcacggaag ccgccaccaa catactcaaa tatgcgggac atggcgagat cgtgctgaaa       180
     agcaccgacg atgcaggggc aagcagtctc gacgtgatcg ctctagatcg cggccccggc       240
     atcgccaatc ttggcgcagc gtgttcggat ggcttttcca cgggcgggag tctcggcgcc       300
     ggcctgggca cgatcgcacg ccattcggcg gttttcgaca tttactcgat tcagggctgc       360
     ggaacggcgc tgtttgcacg cgtcggcgaa aaagccgcgg cagaacaccc gcgctttctg       420
     gtgggcgcca aatccacgcc caagcgcggg caggacatca acggagacgc atggtcggtg       480
     cgccatgcgg gcggcaatct ctggctgacc ctgctcgacg gcctcggcca cggaccgctc       540
     gccgcggagg cgtcgcgccg cgcggtcgac gttttcatgc gcgccgatcc ggcggctctg       600
     ccgcaagaag tgcttcgcga tgtccactcg ggtatcaagg cgacacgcgg cgcagtgatg       660
     gcgattgcca gattcgaccc ggtaaatgcc atcctgtcgt ttgcaggcgt gggtaatatc       720
     gtcggtatcg tgaatgcggg cgagactacg cagcatctgc tttccaccga cggcaccgtc       780
     ggctacaaca tgcgttcggt tcggccgacg gaagcacgct gggcacccgg cagcgtgttt       840
     atcgccacca cggacgggct gaccacacgc tggaacctga accgtcatcc tggcctgatc       900
     agccggcacc ccagcctgat agccagcgtg ctgcatcgcg acttcgcgcg cgacagtgac       960
     gacgcgacga ttgtagtagt caaggcgctt tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page