(data stored in ACNUC7421 zone)

EMBL: CP000271.PE535

CP000271.PE535       Location/Qualifiers
FT   CDS_pept        complement(638591..638980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2488"
FT                   /product="Putative Anti-Sigma regulatory factor (Ser/Thr
FT                   protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2488"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33503"
FT                   /db_xref="GOA:Q13QY6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY6"
FT                   /protein_id="ABE33503.1"
FT                   /translation="MLEIRSADQVNLARKTVQDWATRLAFGTLDRTKFVTAASELARNT
FT                   LVHGRGGTLTISEIERDGRTGIKLVFEDTGPGIPDIEKALQDGFSTARSMGLGLGGARR
FT                   LVNEFEISSTVDVGTKVSIIQWKRR"
     gtgcttgaaa tacgttcggc cgatcaggtc aatctggctc gcaagacggt tcaggattgg        60
     gccacgcggc tggcgttcgg cacgctggac cggacgaaat tcgtcacggc agccagcgaa       120
     ctcgcgcgta acacgctagt gcacggacga ggcggcactc tcacgatttc ggaaatcgag       180
     cgtgacgggc gaactggtat caagctggtt ttcgaggaca ccggtccggg catcccggac       240
     atcgaaaaag cgctacagga cgggttcagt actgccagaa gcatggggct cggcctgggt       300
     ggcgcgcgcc ggctcgtcaa cgagttcgag atctcgtcga cggtggatgt aggaacgaaa       360
     gtgagcatta ttcaatggaa acgacgctaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page