(data stored in ACNUC7421 zone)

EMBL: CP000271.PE536

CP000271.PE536       Location/Qualifiers
FT   CDS_pept        complement(639001..639372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2487"
FT                   /product="Anti-Sigma-factor antagonist (STAS) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2487"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33504"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY5"
FT                   /protein_id="ABE33504.1"
FT                   /translation="MEQIPVLKLGEFLLVSIQVELHDELVLSLQDDLTSRIERTRAKGV
FT                   LIDISALEIVDSFIGRTLGHIAAMARVMDAATVLVGMRPAVAITLVELGMSLHGIRTAL
FT                   DVDKGMALLRKSLEEGGES"
     atggagcaaa tcccggttct caagctcggc gaattcctgc ttgtgtcgat tcaggttgag        60
     ctgcacgatg agctggtgct cagcttgcag gacgacctga cgtcgcgaat cgaacgcacg       120
     cgcgcaaaag gcgtgctaat cgacatttcc gcccttgaaa tagtggattc gttcattggc       180
     cgcacacttg ggcacatcgc ggcaatggcg cgggtgatgg acgcggccac ggtgctggtc       240
     ggcatgcggc cggcggtggc gatcacgctg gtcgagctcg gcatgtcgct gcacggtatc       300
     cggacagcgc tcgatgtcga caagggaatg gctctgctgc gaaagtcgct ggaagaaggg       360
     ggagagtcct ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page